Comparing GFF1548 FitnessBrowser__psRCH2:GFF1548 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
37% identity, 89% coverage: 39:416/423 of query aligns to 14:371/380 of P54955
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 89% coverage: 35:412/423 of query aligns to 52:418/442 of P54968
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 91% coverage: 39:421/423 of query aligns to 52:423/440 of O04373
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
38% identity, 80% coverage: 26:365/423 of query aligns to 10:344/398 of 6slfA
Sites not aligning to the query:
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
32% identity, 90% coverage: 26:406/423 of query aligns to 7:373/389 of 4ewtA
3ramA Crystal structure of hmra (see paper)
25% identity, 69% coverage: 26:316/423 of query aligns to 9:273/391 of 3ramA
Sites not aligning to the query:
>GFF1548 FitnessBrowser__psRCH2:GFF1548
MVVTEAKILPSADHHKSYDRHMNTSDLFQPDEAAMKTWRHAIHQNPELGFAEFATSRLVA
DCLETWGYEVHTGIATTGVVGILRWGDGQPRLGLRADMDALPVQELTGLPWASRTPDQMH
ACGHDGHTSILLGAAQSFALMQREGLLGASGTLTLIFQPAEELGGSGGARRMLDEGLLER
FPCDAVFAMHNYPGIPTGHFRFREGPFMASSDRVVIRFNGKGGHGALPHMAIDPMLPAAA
TVLALQSIVGRNVDPVDAAVISVGRIAAGNTYNVIPETAEMELSVRALRPDVRDLLEMRI
RALVEGQAAAFGVTCEVLYERGYPVLINSARETCLAVEAARALVGDERVEVDGAPISGSE
DFAFILQQVPGCYLLIGNGDNGFGGGEHLGPCSVHNPHYDFNDACLAPGAAFWLTLGSRF
FGC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory