Comparing GFF1560 FitnessBrowser__Phaeo:GFF1560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
35% identity, 99% coverage: 2:384/385 of query aligns to 17:395/395 of 5m3zA
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
35% identity, 99% coverage: 2:384/385 of query aligns to 18:396/396 of 4omaA
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
35% identity, 99% coverage: 2:384/385 of query aligns to 18:396/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
35% identity, 99% coverage: 2:384/385 of query aligns to 18:396/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
35% identity, 99% coverage: 2:384/385 of query aligns to 18:396/396 of 3jw9A
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
35% identity, 99% coverage: 2:384/385 of query aligns to 18:396/396 of 6egrA
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
35% identity, 99% coverage: 2:384/385 of query aligns to 18:396/396 of 4hf8A
3mkjA Methionine gamma-lyase from citrobacter freundii with pyridoximine-5'- phosphate (see paper)
37% identity, 87% coverage: 49:384/385 of query aligns to 50:385/386 of 3mkjA
5dx5A Crystal structure of methionine gamma-lyase from clostridium sporogenes (see paper)
35% identity, 95% coverage: 14:380/385 of query aligns to 26:394/399 of 5dx5A
8j6nA Crystal structure of cystathionine gamma-lyase in complex with compound 1 (see paper)
35% identity, 97% coverage: 10:383/385 of query aligns to 24:388/390 of 8j6nA
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
36% identity, 89% coverage: 38:381/385 of query aligns to 37:377/377 of 7d7oB
5x30C Crystal structure of pseudomonas putida methionine gamma-lyase c116h mutant with l-homocysteine intermediates. (see paper)
35% identity, 96% coverage: 14:383/385 of query aligns to 23:392/393 of 5x30C
3vk3A Crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant complexed with l-methionine (see paper)
35% identity, 96% coverage: 14:383/385 of query aligns to 27:396/397 of 3vk3A
5x5hA Crystal structure of metb from corynebacterium glutamicum (see paper)
36% identity, 95% coverage: 14:380/385 of query aligns to 26:381/385 of 5x5hA
5x2xA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-homocysteine intermediates (see paper)
35% identity, 96% coverage: 14:383/385 of query aligns to 22:391/392 of 5x2xA
5x2wA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-methionine intermediates (see paper)
35% identity, 96% coverage: 14:383/385 of query aligns to 22:391/392 of 5x2wA
1pg8A Crystal structure of l-methionine alpha-, gamma-lyase
35% identity, 96% coverage: 14:383/385 of query aligns to 28:397/398 of 1pg8A
P13254 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methioninase; EC 4.4.1.11; EC 4.4.1.2 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
35% identity, 96% coverage: 14:383/385 of query aligns to 28:397/398 of P13254
1cs1D Cystathionine gamma-synthase (cgs) from escherichia coli (see paper)
38% identity, 91% coverage: 37:385/385 of query aligns to 38:383/384 of 1cs1D
P00935 Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 from Escherichia coli (strain K12) (see paper)
38% identity, 91% coverage: 37:385/385 of query aligns to 40:385/386 of P00935
>GFF1560 FitnessBrowser__Phaeo:GFF1560
MRPDPLPFSASHPVVTPLSPSVVYASETPDALDDQYEGRVHGYTYSREGHPNADVVAKRL
DAMEGMPGGVVTGSGMAAVSAVLLGLLKTGDHVIGGNQLYGRSMRLMAEDLPRLGIETTL
ANPGDVAAVKAAIRPETTMILVEAVSNPTLAVADIDGLAQLCKDRDILLVVDNTFTTPRG
FQPFDHGADIVIHSITKLLAGHSDVMLGYVVAKDPEINTRLSVYVVTTGMTPSPFDCWLA
ERGMLSFELRFERAQATAVTLADHLAGLPGVKRVIYPTRKDHPDHERAMALLDGKGCNMV
SFELEGGRAAANAFTRGADGLNFAPTLGDVGTTLSHPASSSHRALSTEDRAKLGLSEGFF
RISVGLEDPETLCAVFTEAVAAATS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory