Comparing GFF1567 FitnessBrowser__Phaeo:GFF1567 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
7cdyA Crystal structure of glucose dehydrogenase
40% identity, 90% coverage: 35:365/367 of query aligns to 3:343/346 of 7cdyA
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
38% identity, 94% coverage: 23:366/367 of query aligns to 15:368/371 of P75804
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
39% identity, 91% coverage: 32:366/367 of query aligns to 2:346/348 of 2g8sA
7cgzA Glucose dehydrogenase
37% identity, 90% coverage: 35:365/367 of query aligns to 3:318/321 of 7cgzA
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
37% identity, 90% coverage: 32:360/367 of query aligns to 1:318/333 of 2ismB
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
32% identity, 89% coverage: 33:358/367 of query aligns to 4:316/338 of 3a9hA
Sites not aligning to the query:
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
32% identity, 89% coverage: 33:358/367 of query aligns to 4:316/338 of 3a9gA
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
26% identity, 98% coverage: 4:364/367 of query aligns to 6:455/478 of P13650
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
27% identity, 89% coverage: 38:364/367 of query aligns to 22:431/453 of 5minB
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
26% identity, 89% coverage: 38:364/367 of query aligns to 22:425/444 of 1cq1A
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
26% identity, 89% coverage: 38:364/367 of query aligns to 22:425/444 of 1c9uA
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
26% identity, 89% coverage: 38:364/367 of query aligns to 22:429/448 of 1cruA
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
29% identity, 90% coverage: 29:360/367 of query aligns to 4:317/334 of 3dasA
Sites not aligning to the query:
2wfxB Crystal structure of the complex between human hedgehog-interacting protein hip and sonic hedgehog in the presence of calcium (see paper)
26% identity, 52% coverage: 31:220/367 of query aligns to 1:207/417 of 2wfxB
Sites not aligning to the query:
7pgnB Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
26% identity, 52% coverage: 30:220/367 of query aligns to 1:212/438 of 7pgnB
Sites not aligning to the query:
7pgnA Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
26% identity, 52% coverage: 30:220/367 of query aligns to 2:213/437 of 7pgnA
Sites not aligning to the query:
Q96QV1 Hedgehog-interacting protein; HHIP; HIP from Homo sapiens (Human) (see 3 papers)
26% identity, 52% coverage: 30:220/367 of query aligns to 214:432/700 of Q96QV1
Sites not aligning to the query:
7pgmB Hhip-c in complex with heparin (see paper)
26% identity, 52% coverage: 30:220/367 of query aligns to 1:207/427 of 7pgmB
Sites not aligning to the query:
>GFF1567 FitnessBrowser__Phaeo:GFF1567
MSWLAKFTSGAALLLTLATGASAEALTSSQGALRIEKMVQGLDIPWGFDFLPDGSVLISE
RAGNLLLLRDGRLTRIKGTPKVSDQGQGGLLDVMVPRTFAKTRRIYLTYAKRVGRGSATA
VATGQLARRNTQLQGLRDIFVAAPAVSSGRHFGSRLAEGPDGHIYVTLGDRGDRQSAQVL
ASHQGSILRLTPEGSAPRSNPLTKRRGAQPEIWSYGHRNPQGLTFAADGSLWSVEHGARG
GDEVNRIEKGANYGWPIISYGRHYSGLTIGEGTEKPGLKQPQYYWDPSIAPSNLLVYSGK
MWPDWRGDIFVGSLKFDYIARLSGSPLKEVEQVKGEQTGRIRDLREAPDGSIWFASETDG
AIYRLSR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory