Comparing GFF1587 FitnessBrowser__WCS417:GFF1587 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8z1yC Cryo-em structure of escherichia coli dppabcdf in the pre-catalytic state
44% identity, 98% coverage: 2:314/318 of query aligns to 1:318/324 of 8z1yC
8z1xC Cryo-em structure of escherichia coli dppbcdf complex bound to amppnp
44% identity, 98% coverage: 2:314/318 of query aligns to 1:318/326 of 8z1xC
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
46% identity, 97% coverage: 3:312/318 of query aligns to 3:312/611 of 8j5qD
Sites not aligning to the query:
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
46% identity, 97% coverage: 3:312/318 of query aligns to 3:312/608 of 8j5tD
Sites not aligning to the query:
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
46% identity, 97% coverage: 3:312/318 of query aligns to 3:312/608 of 8j5sD
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
39% identity, 100% coverage: 1:317/318 of query aligns to 1:328/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
37% identity, 97% coverage: 3:311/318 of query aligns to 4:317/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
37% identity, 97% coverage: 3:311/318 of query aligns to 3:306/310 of 4fwiB
8z1wD Cryo-em structure of escherichia coli dppbcdf complex bound to atpgammas
38% identity, 92% coverage: 18:310/318 of query aligns to 25:315/326 of 8z1wD
Sites not aligning to the query:
8z1xD Cryo-em structure of escherichia coli dppbcdf complex bound to amppnp
38% identity, 92% coverage: 18:310/318 of query aligns to 24:314/325 of 8z1xD
Sites not aligning to the query:
8xfcD Cryo-em structure of the atp-bound mtb dppabcd with the d445a mutation of dppa
39% identity, 81% coverage: 3:260/318 of query aligns to 4:255/517 of 8xfcD
Sites not aligning to the query:
8wdbD Cryo-em structure of the atp-bound dppabcd complex
39% identity, 81% coverage: 3:260/318 of query aligns to 3:254/513 of 8wdbD
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
40% identity, 73% coverage: 26:257/318 of query aligns to 22:246/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
40% identity, 73% coverage: 26:257/318 of query aligns to 22:246/250 of 7z18I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
40% identity, 73% coverage: 26:257/318 of query aligns to 22:246/250 of 7z16I
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 80% coverage: 3:255/318 of query aligns to 1:241/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 80% coverage: 3:255/318 of query aligns to 2:242/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 80% coverage: 3:255/318 of query aligns to 2:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 80% coverage: 3:255/318 of query aligns to 2:242/344 of 3tuiC
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 73% coverage: 26:256/318 of query aligns to 45:264/382 of 7ahhC
Sites not aligning to the query:
>GFF1587 FitnessBrowser__WCS417:GFF1587
MSLLQVRDLSVIANNAGRDVTLVDRVSFDLAEGEILGLVGESGSGKTMACRGLMRLLPSP
NLRVQGGAVRLGGQDLLSLDDAGMRAVRGGQLGMIFQNPSSHLDPLMRIGEQIAEGIRLH
QGASKKDARLQAIEVLRQVGIPDPQARVDNYPQEFSGGMRQRAMIAVALGCNPKVLIADE
PTTALDVTVQAQILRLLLELRDQRGLSIIMITHDLGVVAQTCDAIAVMYAGCLCEHGSKY
DVLAQPQHPYTAGLIDCQPAHSSGHALLRTIPGQPPLLDALPAGCRFNPRCPQVGALCTE
VLPEGQRVACHYPLGAQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory