Comparing GFF1588 FitnessBrowser__WCS417:GFF1588 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8z1xD Cryo-em structure of escherichia coli dppbcdf complex bound to amppnp
41% identity, 93% coverage: 3:304/323 of query aligns to 3:302/325 of 8z1xD
Sites not aligning to the query:
8z1wD Cryo-em structure of escherichia coli dppbcdf complex bound to atpgammas
41% identity, 93% coverage: 3:304/323 of query aligns to 4:303/326 of 8z1wD
Sites not aligning to the query:
8z1xC Cryo-em structure of escherichia coli dppbcdf complex bound to amppnp
43% identity, 91% coverage: 21:315/323 of query aligns to 12:312/326 of 8z1xC
Sites not aligning to the query:
8z1yC Cryo-em structure of escherichia coli dppabcdf in the pre-catalytic state
43% identity, 91% coverage: 21:315/323 of query aligns to 12:312/324 of 8z1yC
Sites not aligning to the query:
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
50% identity, 74% coverage: 28:265/323 of query aligns to 373:609/611 of 8j5qD
Sites not aligning to the query:
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
49% identity, 73% coverage: 28:263/323 of query aligns to 373:607/608 of 8j5tD
Sites not aligning to the query:
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
49% identity, 73% coverage: 28:263/323 of query aligns to 373:607/608 of 8j5sD
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
37% identity, 98% coverage: 1:316/323 of query aligns to 1:321/330 of P0AAH4
8wdbD Cryo-em structure of the atp-bound dppabcd complex
47% identity, 72% coverage: 29:259/323 of query aligns to 282:513/513 of 8wdbD
Sites not aligning to the query:
8xfcD Cryo-em structure of the atp-bound mtb dppabcd with the d445a mutation of dppa
47% identity, 72% coverage: 29:259/323 of query aligns to 283:514/517 of 8xfcD
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
36% identity, 85% coverage: 28:300/323 of query aligns to 21:299/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
36% identity, 85% coverage: 28:300/323 of query aligns to 20:288/310 of 4fwiB
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 79% coverage: 18:272/323 of query aligns to 8:262/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 79% coverage: 18:272/323 of query aligns to 9:263/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 79% coverage: 18:272/323 of query aligns to 9:263/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 79% coverage: 18:272/323 of query aligns to 9:263/344 of 3tuiC
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
36% identity, 71% coverage: 31:258/323 of query aligns to 18:239/241 of 4u00A
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
34% identity, 72% coverage: 28:258/323 of query aligns to 16:241/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
34% identity, 72% coverage: 28:258/323 of query aligns to 16:241/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
34% identity, 72% coverage: 28:258/323 of query aligns to 16:241/242 of 2olkA
Sites not aligning to the query:
>GFF1588 FitnessBrowser__WCS417:GFF1588
MSLLQIKDLEVKFAASGTGLFGLNKQWVRAVNGVSLSLAAGETLGLVGESGSGKSTLGRA
ILHLNPISAGQVLFDGIDMAHGSAIDITRLRHETAMIFQDPYAALNPRHTIGETIAEVLR
VQRKVAPERISDRVNELLDLVGLRPELASRKPGSLSGGQCQRVGIARALAVEPRLIIADE
CVAALDVSIQGQIINLLLELQQRMHLAILFIAHDLAIVRRLCDRVAVMYLGKIVEEGPVE
SVFTAPRHPYTAALIQAIPEIDPHRPLPTEPLPGEPPSPLNLPTGCAFHPRCRHARTMCS
VVLPPTHFLHEHRYSCVLEEPLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory