SitesBLAST
Comparing GFF1599 FitnessBrowser__Marino:GFF1599 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
29% identity, 93% coverage: 49:771/777 of query aligns to 8:718/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (= M79), G39 (= G80), Q40 (= Q81), H41 (≠ G82), V42 (≠ I83), A45 (≠ S86), G79 (≠ D120), G80 (= G121), S81 (= S122), S83 (= S124), V84 (≠ M125), G374 (= G429), F375 (= F430), L379 (≠ S434), L499 (≠ F545), R500 (= R546), V624 (≠ A675), D625 (≠ N676), Q632 (= Q683), T687 (≠ G740), G688 (= G741), L689 (≠ V742), G690 (= G743), E691 (= E744)
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
24% identity, 46% coverage: 225:579/777 of query aligns to 15:387/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
6a7xB Rat xanthine oxidoreductase, d428a variant, NAD bound form
25% identity, 34% coverage: 213:480/777 of query aligns to 527:825/1291 of 6a7xB
Sites not aligning to the query:
- active site: 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 880, 881, 885, 886, 889
- binding flavin-adenine dinucleotide: 44, 227, 228, 229, 230, 231, 232, 233, 234, 307, 312, 317, 320, 321, 323, 324, 330, 373, 374
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 327, 363, 364, 428, 430, 431, 471, 478
- binding uric acid: 851, 885, 980, 981, 1049, 1050, 1232
2e3tA Crystal structure of rat xanthine oxidoreductase mutant (w335a and f336l) (see paper)
25% identity, 34% coverage: 213:480/777 of query aligns to 529:827/1291 of 2e3tA
Sites not aligning to the query:
- active site: 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 850, 882, 883, 887, 888, 891
- binding calcium ion: 840, 843, 844, 847, 880, 881
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 113, 145, 147
- binding uric acid: 853, 887, 982, 983, 1051, 1052, 1234
P22985 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 34% coverage: 213:480/777 of query aligns to 556:854/1331 of P22985
Sites not aligning to the query:
- 43 binding
- 48 binding
- 51 binding
- 73 binding
- 112 binding
- 115 binding
- 147 binding
- 149 binding
- 256:263 binding
- 335:336 WF→AL: Converts the enzyme to the oxidase form that utilizes molecular oxygen as electron acceptor. Interferes with normal conversion to the dehydrogenase form by reducing agents.
- 346:350 binding
- 359 binding
- 403 binding
- 535 C→A: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with R-992. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with R-992 and S-1316.
- 992 C→R: Slows the conversion from the dehydrogenase form to the oxidase form; when associated with A-535. Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and S-1316.
- 1316 C→S: Abolishes conversion from the dehydrogenase form to the oxidase form; when associated with A-535 and R-992.
4yswA Structure of rat xanthine oxidoreductase, c-terminal deletion protein variant, nadh bound form (see paper)
25% identity, 34% coverage: 213:480/777 of query aligns to 527:825/1286 of 4yswA
Sites not aligning to the query:
- active site: 851, 855, 883, 1231, 1232
- binding bicarbonate ion: 848, 880, 881, 882, 885, 886, 889
- binding calcium ion: 838, 841, 842, 845, 878, 879
- binding flavin-adenine dinucleotide: 44, 226, 227, 228, 229, 230, 231, 232, 233, 234, 307, 308, 312, 316, 317, 320, 321, 323, 324, 329, 330, 373, 374, 399
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 113, 145, 147
- binding 1,4-dihydronicotinamide adenine dinucleotide: 233, 326, 327, 328, 363, 364, 400, 401, 428, 430, 431, 471, 478, 1196
- binding uric acid: 851, 885, 980, 981, 1050, 1232
6a7xA Rat xanthine oxidoreductase, d428a variant, NAD bound form
25% identity, 34% coverage: 213:480/777 of query aligns to 529:827/1295 of 6a7xA
Sites not aligning to the query:
- active site: 853, 857, 885, 1233, 1234
- binding bicarbonate ion: 850, 883, 884, 887, 888, 891
- binding flavin-adenine dinucleotide: 44, 228, 229, 230, 231, 232, 233, 234, 235, 236, 309, 314, 319, 322, 323, 325, 326, 332, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 109, 110, 111, 113, 145, 147
- binding nicotinamide-adenine-dinucleotide: 329, 365, 366, 432, 433, 473, 480
- binding uric acid: 853, 887, 982, 983, 1052, 1234
3nvzC Crystal structure of bovine xanthine oxidase in complex with indole-3- aldehyde (see paper)
25% identity, 36% coverage: 231:510/777 of query aligns to 17:320/755 of 3nvzC
Sites not aligning to the query:
3nvvC Crystal structure of bovine xanthine oxidase in complex with arsenite (see paper)
25% identity, 36% coverage: 231:510/777 of query aligns to 17:320/755 of 3nvvC
Sites not aligning to the query:
3ns1C Crystal structure of bovine xanthine oxidase in complex with 6- mercaptopurine (see paper)
25% identity, 36% coverage: 231:510/777 of query aligns to 17:320/755 of 3ns1C
Sites not aligning to the query:
3etrC Crystal structure of xanthine oxidase in complex with lumazine (see paper)
25% identity, 36% coverage: 231:510/777 of query aligns to 17:320/755 of 3etrC
Sites not aligning to the query:
3sr6C Crystal structure of reduced bovine xanthine oxidase in complex with arsenite (see paper)
25% identity, 36% coverage: 231:510/777 of query aligns to 17:320/745 of 3sr6C
Sites not aligning to the query:
3nvyC Crystal structure of bovine xanthine oxidase in complex with quercetin (see paper)
25% identity, 36% coverage: 231:510/777 of query aligns to 17:320/756 of 3nvyC
- active site: Q197 (= Q399), E232 (≠ S434), R310 (≠ G500), H314 (≠ A504)
- binding 3,5,7,3',4'-pentahydroxyflavone: L78 (≠ G288), E232 (≠ S434), L303 (= L495), R310 (≠ G500)
Sites not aligning to the query:
- active site: 342, 690, 691
- binding 3,5,7,3',4'-pentahydroxyflavone: 344, 439, 440, 444, 509
3nvwC Crystal structure of bovine xanthine oxidase in complex with guanine (see paper)
25% identity, 36% coverage: 231:510/777 of query aligns to 17:320/756 of 3nvwC
Sites not aligning to the query:
3eub4 Crystal structure of desulfo-xanthine oxidase with xanthine (see paper)
25% identity, 36% coverage: 231:510/777 of query aligns to 17:320/756 of 3eub4
Sites not aligning to the query:
2ckjA Human milk xanthine oxidoreductase
25% identity, 36% coverage: 202:480/777 of query aligns to 491:798/1264 of 2ckjA
Sites not aligning to the query:
- active site: 824, 828, 856, 1204, 1205
- binding flavin-adenine dinucleotide: 228, 230, 231, 232, 233, 234, 308, 309, 317, 318, 321, 322, 324, 325, 331, 375
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 147, 148
3b9jC Structure of xanthine oxidase with 2-hydroxy-6-methylpurine (see paper)
25% identity, 36% coverage: 231:510/777 of query aligns to 17:320/758 of 3b9jC
Sites not aligning to the query:
3ax7A Bovine xanthine oxidase, protease cleaved form (see paper)
25% identity, 36% coverage: 231:510/777 of query aligns to 486:789/1225 of 3ax7A
- active site: Q666 (= Q399), E701 (≠ S434), R779 (≠ G500), H783 (≠ A504)
- binding bicarbonate ion: R738 (≠ H465), H739 (= H466), I776 (= I499)
- binding calcium ion: A766 (≠ G489), S769 (≠ H492), R770 (= R493), S773 (= S496)
- binding fe2/s2 (inorganic) cluster: L643 (≠ M378)
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: G695 (= G428), G696 (= G429), F697 (= F430), G698 (= G431)
Sites not aligning to the query:
- active site: 811, 1159, 1160
- binding bicarbonate ion: 808, 809, 814, 817
- binding calcium ion: 806, 807
- binding flavin-adenine dinucleotide: 45, 197, 198, 199, 200, 201, 202, 203, 204, 205, 278, 279, 283, 287, 288, 291, 292, 294, 295, 300, 301, 345
- binding fe2/s2 (inorganic) cluster: 41, 42, 43, 45, 47, 48, 50, 70, 72, 112, 113, 115, 147, 149
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 111, 149, 810, 811, 937, 938, 939, 977, 978, 979, 981, 1093, 1160
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
25% identity, 34% coverage: 215:480/777 of query aligns to 559:855/1333 of P47989
- D584 (vs. gap) to A: in dbSNP:rs45491693
- R607 (≠ V249) to Q: in dbSNP:rs45442092
- K617 (≠ T259) to N: in dbSNP:rs45442398
- T623 (≠ D265) to I: in dbSNP:rs45448694
- I646 (≠ V274) to V: in dbSNP:rs17323225
- I703 (≠ L336) to V: in dbSNP:rs17011368
- L763 (≠ V394) to F: in a breast cancer sample; somatic mutation
- R791 (≠ H422) to G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 257:264 binding
- 337 binding
- 347:351 binding
- 360 binding
- 395 K → M: in dbSNP:rs34929837
- 422 binding
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 555 P → S: in dbSNP:rs45577338
- 910 T → M: in dbSNP:rs669884
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
25% identity, 34% coverage: 215:480/777 of query aligns to 533:829/1307 of 2e1qA
- active site: Q742 (= Q399), V777 (≠ S434)
- binding bicarbonate ion: R814 (≠ H465), H815 (= H466)
- binding calcium ion: E715 (≠ A374), H716 (≠ Q375), Y718 (≠ P377), T741 (≠ V398), T747 (= T404), S780 (≠ D437), T781 (≠ F438), S784 (≠ E441), T811 (vs. gap), G812 (vs. gap)
- binding fe2/s2 (inorganic) cluster: L719 (≠ M378)
- binding hydroxy(dioxo)molybdenum: F773 (= F430), G774 (= G431)
Sites not aligning to the query:
- active site: 855, 859, 887, 1235, 1236
- binding bicarbonate ion: 852, 886, 889, 890, 893
- binding flavin-adenine dinucleotide: 43, 44, 230, 231, 232, 233, 234, 235, 236, 237, 238, 311, 312, 316, 320, 321, 324, 325, 327, 328, 333, 334, 377, 378
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding hydroxy(dioxo)molybdenum: 887, 1053, 1054, 1236
Query Sequence
>GFF1599 FitnessBrowser__Marino:GFF1599
MSADDNLMIANVSRRRFLMGLAGGSALVLAARWDVALAGNEKAQFGAGAMPGGWVDDPNV
FIHIDADGLVTIVNNRSEMGQGIRTSLVMVGADELGADWDQVRVEQAEGDHDKYGNQNTD
GSRSMRHWYQPMRRAAAAARQMLEQAAANEWGVPVSEVQAGVHTIVHRPSGKELGFGELA
AKARELDVPGRNALVLKRDDELRFVGKETGLINGELKSAYPKAIDGEDIVTGKAVYGADV
PFEGLLYAVIARPPVYGATVGDFDDTEALKVPGVEKVLKVEGTGQPAGFSPLGGIAVVAS
NTWAAMEGRKALKIDWNLEPAGDNASYTSATYRESLEKAAQQPGKVVRQHGDLDTALENA
DKRVSATYYMPHMAQAPMEPPVATVRIKDGKAEVWAPVQNPQATRDTVAGRLGLDAENVT
VHVTLLGGGFGRKSKPDFAIEAASIAEAFKGRPVRLQWSREDDIHHAYYHAVSVDYLEAG
LDNNGQATGWLHRTLSPSIGSLFAPDPKHKGEFELGMGFNTMPFSVPALRLENPPAPAHV
RIGWFRSVYNLPHAWAIQSFAHEMAVAAGKDHRDYVLDLLGPDREIHNLTVGDGWNYGED
PDLYPIDIGRMRNVIERVTREADWGKSTGKNRGLGLAFHHSFVSYTAIVFDVEVDDQGEL
TIHRADIAFDCGPQANPERIRSQLEGAIVMGIGIALQSEVTFEDGVAQQGNFDKYLIPRM
PDAPKTLRVHLVDNPDEAMGGVGEPGLPPVAPALCNAIYAATGKRIRRLPVGDQLKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory