SitesBLAST
Comparing GFF1599 FitnessBrowser__WCS417:GFF1599 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
55% identity, 59% coverage: 300:730/736 of query aligns to 1:431/440 of 3slhD
- active site: K23 (= K322), S24 (= S323), D50 (= D349), N95 (= N393), R125 (= R423), D317 (= D616), E345 (= E644), H388 (= H687), R389 (= R688), T415 (= T714)
- binding glyphosate: K23 (= K322), G97 (= G395), T98 (= T396), R125 (= R423), Q171 (= Q470), D317 (= D616), E345 (= E644), R348 (= R647), H388 (= H687), R389 (= R688)
- binding shikimate-3-phosphate: S24 (= S323), R28 (= R327), S169 (= S468), Q171 (= Q470), R196 (= R495), D317 (= D616), K344 (= K643)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S323), R28 (= R327), T98 (= T396), Q171 (= Q470), R196 (= R495), D317 (= D616), K344 (= K643)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
55% identity, 58% coverage: 302:730/736 of query aligns to 1:429/438 of Q83E11
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
55% identity, 59% coverage: 300:730/736 of query aligns to 1:427/434 of 4egrA
- active site: K23 (= K322), S24 (= S323), D50 (= D349), N95 (= N393), R125 (= R423), D313 (= D616), E341 (= E644), H384 (= H687), R385 (= R688), T411 (= T714)
- binding phosphoenolpyruvate: K23 (= K322), G97 (= G395), T98 (= T396), R125 (= R423), D313 (= D616), E341 (= E644), R344 (= R647), R385 (= R688)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
48% identity, 56% coverage: 312:720/736 of query aligns to 10:418/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
48% identity, 56% coverage: 312:720/736 of query aligns to 10:418/427 of 1rf6A
- active site: K20 (= K322), S21 (= S323), D47 (= D349), N90 (= N393), D115 (≠ A418), R120 (= R423), D312 (= D616), E340 (= E644), H384 (= H687), R385 (= R688), T412 (= T714)
- binding glyphosate: K20 (= K322), G92 (= G395), T93 (= T396), R120 (= R423), Q168 (= Q470), D312 (= D616), E340 (= E644), R343 (= R647), H384 (= H687), R385 (= R688)
- binding shikimate-3-phosphate: S21 (= S323), R25 (= R327), S166 (= S468), Q168 (= Q470), R193 (= R495), I311 (= I615), D312 (= D616), K339 (= K643)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
48% identity, 56% coverage: 312:720/736 of query aligns to 10:418/427 of 1rf4A
- active site: K20 (= K322), S21 (= S323), D47 (= D349), N90 (= N393), D115 (≠ A418), R120 (= R423), D312 (= D616), E340 (= E644), H384 (= H687), R385 (= R688), T412 (= T714)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K322), S21 (= S323), R25 (= R327), G92 (= G395), T93 (= T396), R120 (= R423), S166 (= S468), A167 (= A469), Q168 (= Q470), R193 (= R495), D312 (= D616), K339 (= K643), E340 (= E644), R343 (= R647), H384 (= H687), R385 (= R688)
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
48% identity, 57% coverage: 312:730/736 of query aligns to 13:442/445 of 2pqcA
- active site: K23 (= K322), S24 (= S323), D50 (= D349), N93 (= N393), R123 (= R423), D321 (= D616), E349 (= E644), H399 (= H687), R400 (= R688), T426 (= T714)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K322), S24 (= S323), R28 (= R327), T96 (= T396), R123 (= R423), S168 (= S468), Q170 (= Q470), D321 (= D616), K348 (= K643), E349 (= E644), R352 (= R647), R400 (= R688)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
48% identity, 57% coverage: 312:730/736 of query aligns to 13:442/445 of 2pqbA
- active site: K23 (= K322), S24 (= S323), D50 (= D349), N93 (= N393), R123 (= R423), D321 (= D616), E349 (= E644), H399 (= H687), R400 (= R688), T426 (= T714)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K322), S24 (= S323), R28 (= R327), A95 (≠ G395), T96 (= T396), R123 (= R423), S168 (= S468), Q170 (= Q470), D321 (= D616), K348 (= K643), E349 (= E644), R352 (= R647), R400 (= R688)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
48% identity, 57% coverage: 312:730/736 of query aligns to 13:442/445 of 2ggaA
- active site: K23 (= K322), S24 (= S323), D50 (= D349), N93 (= N393), R123 (= R423), D321 (= D616), E349 (= E644), H399 (= H687), R400 (= R688), T426 (= T714)
- binding glyphosate: K23 (= K322), A94 (≠ S394), A95 (≠ G395), T96 (= T396), R123 (= R423), D321 (= D616), E349 (= E644), R352 (= R647), R400 (= R688)
- binding shikimate-3-phosphate: S24 (= S323), R28 (= R327), S168 (= S468), A169 (= A469), Q170 (= Q470), R195 (= R495), D321 (= D616), K348 (= K643)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
48% identity, 57% coverage: 312:730/736 of query aligns to 13:442/445 of 2gg6A
- active site: K23 (= K322), S24 (= S323), D50 (= D349), N93 (= N393), R123 (= R423), D321 (= D616), E349 (= E644), H399 (= H687), R400 (= R688), T426 (= T714)
- binding shikimate-3-phosphate: S24 (= S323), R28 (= R327), T96 (= T396), S168 (= S468), Q170 (= Q470), D321 (= D616), K348 (= K643)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
48% identity, 57% coverage: 312:730/736 of query aligns to 18:447/455 of Q9R4E4
- KS 28:29 (= KS 322:323) binding
- R33 (= R327) binding
- NAAT 98:101 (≠ NSGT 393:396) Phosphoenolpyruvate
- A100 (≠ G395) mutation to G: Confers resistance to glyphosate.
- R128 (= R423) binding
- K353 (= K643) binding
- R357 (= R647) binding
- R405 (= R688) binding
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
40% identity, 38% coverage: 4:280/736 of query aligns to 15:290/293 of 3gggD
- binding nicotinamide-adenine-dinucleotide: V21 (≠ L10), G22 (= G11), F23 (≠ L12), M24 (≠ I13), D45 (= D34), I46 (≠ L35), S50 (= S39), S81 (≠ A69), S82 (≠ V70), P83 (= P71), V84 (≠ I72), T86 (≠ A74), Q107 (≠ V95), S109 (= S97), G134 (= G125), T135 (≠ S126)
- binding tyrosine: G225 (≠ A215), G226 (= G216)
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
40% identity, 38% coverage: 4:280/736 of query aligns to 7:282/285 of 3ggoA
- binding 3-(4-hydroxy-phenyl)pyruvic acid: G217 (≠ A215), G218 (= G216), G219 (= G217)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V13 (≠ L10), G14 (= G11), F15 (≠ L12), M16 (≠ I13), D37 (= D34), I38 (≠ L35), S42 (= S39), S73 (≠ A69), S74 (≠ V70), P75 (= P71), T78 (≠ A74), Q99 (≠ V95), S101 (= S97), A125 (= A124), G131 (= G130), M233 (= M231)
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
40% identity, 38% coverage: 4:280/736 of query aligns to 7:282/286 of 3ggpA
- binding hydroxyphenyl propionic acid: G218 (= G216), G219 (= G217)
- binding nicotinamide-adenine-dinucleotide: V13 (≠ L10), G14 (= G11), F15 (≠ L12), M16 (≠ I13), D37 (= D34), I38 (≠ L35), S42 (= S39), S73 (≠ A69), S74 (≠ V70), P75 (= P71), T78 (≠ A74), Q99 (≠ V95), S101 (= S97), G131 (= G130), M233 (= M231)
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
43% identity, 38% coverage: 5:280/736 of query aligns to 7:283/293 of 4wjiA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G9), G13 (= G11), L14 (= L12), I15 (= I13), T36 (≠ D34), R37 (≠ L35), S38 (≠ D36), T41 (≠ S39), S71 (≠ A69), V72 (= V70), P73 (= P71), A76 (= A74), V97 (= V95), S99 (= S97), A125 (= A124), S130 (= S129), M234 (= M231)
- binding tyrosine: S99 (= S97), H122 (= H121), A125 (= A124), T127 (≠ S126), R226 (= R223)
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
37% identity, 38% coverage: 1:281/736 of query aligns to 8:288/373 of 5uyyA
Sites not aligning to the query:
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
38% identity, 38% coverage: 4:281/736 of query aligns to 3:280/365 of 6u60B
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), L11 (= L12), I12 (= I13), D32 (= D34), I33 (≠ L35), A67 (= A69), P69 (= P71), E72 (≠ A74), V94 (= V95), S96 (= S97), G128 (= G130)
- binding tyrosine: K126 (≠ Q128)
Sites not aligning to the query:
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
36% identity, 38% coverage: 5:282/736 of query aligns to 9:284/286 of 3b1fA
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
31% identity, 57% coverage: 307:726/736 of query aligns to 7:424/426 of 3nvsA
- active site: K22 (= K322), S23 (= S323), D49 (= D349), N94 (= N393), P119 (≠ A418), R124 (= R423), H128 (≠ R427), Q135 (≠ E434), Y142 (≠ T441), E144 (≠ G442), A247 (≠ S538), A255 (≠ S546), D314 (≠ E608), E342 (= E644), H386 (= H687), R387 (= R688), K412 (≠ T714)
- binding glyphosate: K22 (= K322), G96 (= G395), R124 (= R423), Q172 (= Q470), D314 (≠ E608), E342 (= E644), R345 (= R647), H386 (= H687), R387 (= R688)
- binding magnesium ion: E123 (≠ K422), Q145 (≠ P443)
- binding shikimate-3-phosphate: K22 (= K322), S23 (= S323), R27 (= R327), T97 (= T396), S170 (= S468), S171 (≠ A469), Q172 (= Q470), S198 (≠ P491), Y201 (≠ T494), D314 (≠ E608), N337 (≠ E639), K341 (= K643)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S323), R27 (= R327), Q172 (= Q470), Y201 (≠ T494), D314 (≠ E608), K341 (= K643)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
31% identity, 57% coverage: 307:726/736 of query aligns to 7:424/426 of Q9KRB0
Query Sequence
>GFF1599 FitnessBrowser__WCS417:GFF1599
MIGRLVVIGLGLIGGSFAKGLRESGLCSEVVGVDLDPQSRKLAVELGVVDRCEADLALAC
QGADVIQLAVPILAMEKLLGVLAGMDLGQAILTDVGSAKGNVVRAAQRAFGGMPARFVPG
HPIAGSEQSGVEASNAQLFRRHKVILTPLEQTDPAALAVVDRLWRELGADVEHMQVERHD
EVLAATSHLPHLLAFGLVDSLAKRNENLDIFRYAAGGFRDFTRIAGSDPVMWHDIFLANR
EAVLRTLDTFRSDLDALRDAVDAGDGHQLLGVFTRARVAREHFSKILARRAYMETAVTAD
ELTFLAEPGGRLSGRIRVPGDKSISHRSIMLGSLAEGVTEVEGFLEGEDALATLQAFRDM
GVVIEGPHHGRVTIHGVGLHGLKPAPGPIYLGNSGTSMRLLSGLLAAQSFDSVLTGDASL
SKRPMSRVAKPLREMGAVIETGPEGRPPLTIRGGQSLKGLAYAMPMASAQVKSCLLLAGL
YAEGKTVVAEPAPTRDHTERMLRGFGYPVAVEGATASVESGHALAATHIEVPGDISSSAF
FLVAASIAEGSELLLEHVGVNPTRTGVIDILRLMGADITLENQREVGGEPVADLRVRAAA
LKGIEIPEALVPLAIDEFPVLFVAAACAEGRTVLRGAQELRVKESDRIQVMADGLLALGV
KCEPTADGIIIDGGLIGGGEVHAHGDHRIAMAFSVASLRAATPIRIRDCANVATSFPNFL
TLCAQVGIRVAQEAQL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory