SitesBLAST
Comparing GFF1600 FitnessBrowser__Phaeo:GFF1600 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
34% identity, 98% coverage: 13:753/756 of query aligns to 3:759/761 of 1rm6A
- active site: Q206 (= Q230), T241 (= T265), Y318 (≠ M341), L322 (≠ A345), R350 (= R370), E718 (= E712), G719 (≠ T713)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G235 (= G259), G236 (= G260), F237 (= F261), G238 (= G262), R350 (= R370), I473 (= I480), G474 (= G481), Q475 (vs. gap), G476 (= G482), Y513 (≠ H519), S514 (≠ G520), S515 (= S521), V517 (= V523), T518 (= T524), L646 (≠ I639), N647 (≠ H640), V651 (= V644), Q654 (= Q647), K714 (≠ R708), E715 (≠ G709), A716 (≠ V710), S717 (≠ G711), E718 (= E712)
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
34% identity, 98% coverage: 13:753/756 of query aligns to 11:767/769 of O33819
P19919 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
28% identity, 96% coverage: 5:729/756 of query aligns to 13:780/809 of P19919
- C388 (≠ A371) binding
- E763 (= E712) binding
1n60B Crystal structure of the cu,mo-co dehydrogenase (codh); cyanide- inactivated form (see paper)
28% identity, 96% coverage: 5:729/756 of query aligns to 7:774/803 of 1n60B
- active site: Q234 (= Q230), V269 (≠ T265), P346 (= P335), I352 (≠ M341), R381 (= R370), C382 (≠ A371), E757 (= E712), S758 (≠ T713)
- binding pterin cytosine dinucleotide: G264 (= G260), F265 (= F261), R381 (= R370), Q522 (≠ I480), G523 (= G481), Q524 (vs. gap), H526 (≠ S483), T529 (≠ S486), T561 (≠ S518), Y562 (≠ H519), G563 (= G520), S564 (= S521), S566 (≠ V523), T567 (= T524), C680 (≠ A635), I684 (= I639), I688 (≠ Y643), I689 (≠ V644), Q692 (= Q647), K753 (≠ R708), G754 (= G709), V755 (= V710), E757 (= E712)
- binding mo(vi)(=o)(oh)2 cluster: F265 (= F261), G266 (= G262), Y562 (≠ H519), G563 (= G520), E757 (= E712)
1n62B Crystal structure of the mo,cu-co dehydrogenase (codh), n- butylisocyanide-bound state (see paper)
28% identity, 96% coverage: 5:729/756 of query aligns to 8:775/804 of 1n62B
- active site: Q235 (= Q230), V270 (≠ T265), P347 (= P335), I353 (≠ M341), R382 (= R370), C383 (≠ A371), E758 (= E712), S759 (≠ T713)
- binding cu(i)-s-mo(iv)(=o)o-nbic cluster: G267 (= G262), V379 (≠ A367), A380 (= A368), R382 (= R370), C383 (≠ A371), F385 (≠ G373), Y563 (≠ H519), G564 (= G520), E758 (= E712)
- binding pterin cytosine dinucleotide: G265 (= G260), F266 (= F261), R382 (= R370), Q523 (≠ I480), G524 (= G481), Q525 (vs. gap), H527 (≠ S483), T530 (≠ S486), T562 (≠ S518), Y563 (≠ H519), G564 (= G520), S565 (= S521), S567 (≠ V523), T568 (= T524), C681 (≠ A635), I685 (= I639), I689 (≠ Y643), I690 (≠ V644), Q693 (= Q647), K754 (≠ R708), G755 (= G709), V756 (= V710), G757 (= G711), E758 (= E712)
1n5wB Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
28% identity, 96% coverage: 5:729/756 of query aligns to 8:775/804 of 1n5wB
- active site: Q235 (= Q230), V270 (≠ T265), P347 (= P335), I353 (≠ M341), R382 (= R370), C383 (≠ A371), E758 (= E712), S759 (≠ T713)
- binding cu(i)-s-mo(vi)(=o)oh cluster: G267 (= G262), A380 (= A368), R382 (= R370), C383 (≠ A371), Y563 (≠ H519), G564 (= G520), E758 (= E712)
- binding pterin cytosine dinucleotide: G265 (= G260), F266 (= F261), R382 (= R370), Q523 (≠ I480), G524 (= G481), Q525 (vs. gap), H527 (≠ S483), T530 (≠ S486), T562 (≠ S518), Y563 (≠ H519), S565 (= S521), S567 (≠ V523), T568 (= T524), C681 (≠ A635), I685 (= I639), I689 (≠ Y643), I690 (≠ V644), Q693 (= Q647), K754 (≠ R708), G755 (= G709), V756 (= V710), E758 (= E712)
1zxiB Reconstituted co dehydrogenase from oligotropha carboxidovorans (see paper)
28% identity, 96% coverage: 5:729/756 of query aligns to 8:775/804 of 1zxiB
- active site: Q235 (= Q230), V270 (≠ T265), P347 (= P335), I353 (≠ M341), R382 (= R370), C383 (≠ A371), E758 (= E712), S759 (≠ T713)
- binding copper (ii) ion: C383 (≠ A371), S384 (≠ P372), E758 (= E712)
- binding cu(i)-s-mo(vi)(=o)oh cluster: F266 (= F261), G267 (= G262), A380 (= A368), Y381 (= Y369), R382 (= R370), C383 (≠ A371), Y563 (≠ H519), G564 (= G520), E758 (= E712)
- binding pterin cytosine dinucleotide: G265 (= G260), F266 (= F261), R382 (= R370), Q523 (≠ I480), G524 (= G481), Q525 (vs. gap), H527 (≠ S483), T530 (≠ S486), T562 (≠ S518), Y563 (≠ H519), S565 (= S521), S567 (≠ V523), T568 (= T524), C681 (≠ A635), I685 (= I639), I689 (≠ Y643), I690 (≠ V644), Q693 (= Q647), K754 (≠ R708), G755 (= G709), V756 (= V710), E758 (= E712)
1n63B Crystal structure of the cu,mo-co dehydrogenase (codh); carbon monoxide reduced state (see paper)
28% identity, 96% coverage: 5:729/756 of query aligns to 9:776/805 of 1n63B
- active site: Q236 (= Q230), V271 (≠ T265), P348 (= P335), I354 (≠ M341), R383 (= R370), C384 (≠ A371), E759 (= E712), S760 (≠ T713)
- binding cu(i)-s-mo(iv)(=o)oh cluster: G268 (= G262), A381 (= A368), R383 (= R370), C384 (≠ A371), Y564 (≠ H519), G565 (= G520), E759 (= E712)
- binding pterin cytosine dinucleotide: G266 (= G260), F267 (= F261), R383 (= R370), Q524 (≠ I480), G525 (= G481), Q526 (vs. gap), H528 (≠ S483), T531 (≠ S486), T563 (≠ S518), Y564 (≠ H519), S566 (= S521), S568 (≠ V523), T569 (= T524), C682 (≠ A635), I686 (= I639), I690 (≠ Y643), I691 (≠ V644), Q694 (= Q647), K755 (≠ R708), G756 (= G709), V757 (= V710), E759 (= E712)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
29% identity, 97% coverage: 14:748/756 of query aligns to 177:905/907 of 4usaA
- active site: I390 (≠ Q230), F425 (≠ T265), R501 (vs. gap), F505 (≠ C342), R533 (= R370), E869 (= E712), L870 (≠ T713)
- binding bicarbonate ion: R460 (≠ T300), A531 (= A368), F532 (≠ Y369), Y535 (≠ P372), Q539 (≠ M376)
- binding hydrocinnamic acid: I255 (≠ K84), F425 (≠ T265), F494 (≠ A334), L497 (≠ D337), Y535 (≠ P372), L626 (vs. gap)
- binding magnesium ion: E899 (≠ P742), E903 (≠ A746)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ G260), F421 (= F261), G422 (= G262), R533 (= R370), W650 (≠ T477), H653 (≠ I480), G654 (= G481), Q655 (vs. gap), G656 (= G482), S695 (= S518), G696 (≠ H519), G697 (= G520), Q700 (≠ V523), Q701 (≠ T524), C799 (≠ I639), N800 (≠ H640), T804 (≠ V644), Q807 (= Q647), S865 (≠ R708), G866 (= G709), V867 (= V710), G868 (= G711), E869 (= E712)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
29% identity, 97% coverage: 14:748/756 of query aligns to 177:905/907 of 4us9A
- active site: I390 (≠ Q230), F425 (≠ T265), R501 (vs. gap), F505 (≠ C342), R533 (= R370), E869 (= E712), L870 (≠ T713)
- binding 3-phenylpropanal: I255 (≠ K84), F257 (≠ A86), P258 (= P87), H752 (= H596)
- binding bicarbonate ion: R460 (≠ T300), L498 (≠ M338), A531 (= A368), F532 (≠ Y369), Y535 (≠ P372), Q539 (≠ M376), R890 (= R733), Y892 (≠ H735)
- binding magnesium ion: E899 (≠ P742), E903 (≠ A746)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ G260), F421 (= F261), G422 (= G262), R533 (= R370), W650 (≠ T477), H653 (≠ I480), G654 (= G481), Q655 (vs. gap), G656 (= G482), S695 (= S518), G696 (≠ H519), G697 (= G520), Q700 (≠ V523), Q701 (≠ T524), C799 (≠ I639), N800 (≠ H640), T804 (≠ V644), Q807 (= Q647), S865 (≠ R708), G866 (= G709), V867 (= V710), G868 (= G711), E869 (= E712)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
29% identity, 97% coverage: 14:748/756 of query aligns to 177:905/907 of 4us8A
- active site: I390 (≠ Q230), F425 (≠ T265), R501 (vs. gap), F505 (≠ C342), R533 (= R370), E869 (= E712), L870 (≠ T713)
- binding bicarbonate ion: R460 (≠ T300), L498 (≠ M338), A531 (= A368), F532 (≠ Y369), Y535 (≠ P372), Q539 (≠ M376)
- binding benzaldehyde: I255 (≠ K84), I255 (≠ K84), L394 (vs. gap), F425 (≠ T265), F425 (≠ T265), F425 (≠ T265), F425 (≠ T265), L497 (≠ D337), L497 (≠ D337), R501 (vs. gap), A531 (= A368), Y535 (≠ P372), Y535 (≠ P372), L626 (vs. gap), L626 (vs. gap), L626 (vs. gap), P694 (≠ V517), G696 (≠ H519), G697 (= G520)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ G260), F421 (= F261), G422 (= G262), R533 (= R370), H653 (≠ I480), G654 (= G481), Q655 (vs. gap), G656 (= G482), S695 (= S518), G696 (≠ H519), G697 (= G520), Q700 (≠ V523), Q701 (≠ T524), C799 (≠ I639), N800 (≠ H640), T804 (≠ V644), Q807 (= Q647), S865 (≠ R708), G866 (= G709), V867 (= V710), G868 (= G711), E869 (= E712)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
29% identity, 97% coverage: 14:748/756 of query aligns to 177:905/907 of 4c7yA
- active site: I390 (≠ Q230), F425 (≠ T265), R501 (vs. gap), F505 (≠ C342), R533 (= R370), E869 (= E712), L870 (≠ T713)
- binding bicarbonate ion: R460 (≠ T300), L498 (≠ M338), A531 (= A368), Y535 (≠ P372), Q539 (≠ M376)
- binding magnesium ion: E899 (≠ P742), E903 (≠ A746)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ G260), F421 (= F261), G422 (= G262), R533 (= R370), W650 (≠ T477), H653 (≠ I480), G654 (= G481), Q655 (vs. gap), G656 (= G482), S695 (= S518), G696 (≠ H519), Q700 (≠ V523), Q701 (≠ T524), C799 (≠ I639), N800 (≠ H640), T804 (≠ V644), Q807 (= Q647), S865 (≠ R708), G866 (= G709), V867 (= V710), G868 (= G711), E869 (= E712)
- binding hydrogen peroxide: G696 (≠ H519), G697 (= G520), E869 (= E712)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
29% identity, 97% coverage: 14:748/756 of query aligns to 177:905/907 of 3fc4A
- active site: I390 (≠ Q230), F425 (≠ T265), R501 (vs. gap), F505 (≠ C342), R533 (= R370), E869 (= E712), L870 (≠ T713)
- binding 1,2-ethanediol: Y535 (≠ P372), Y622 (≠ W452), G696 (≠ H519), G697 (= G520), E869 (= E712)
- binding magnesium ion: E899 (≠ P742), E903 (≠ A746)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G419 (= G259), T420 (≠ G260), F421 (= F261), G422 (= G262), R533 (= R370), W650 (≠ T477), H653 (≠ I480), G654 (= G481), Q655 (vs. gap), G656 (= G482), S695 (= S518), G696 (≠ H519), Q700 (≠ V523), Q701 (≠ T524), C799 (≠ I639), N800 (≠ H640), T804 (≠ V644), Q807 (= Q647), S865 (≠ R708), G866 (= G709), V867 (= V710), G868 (= G711), E869 (= E712)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
29% identity, 97% coverage: 14:748/756 of query aligns to 177:905/907 of 3fahA
- active site: I390 (≠ Q230), F425 (≠ T265), R501 (vs. gap), F505 (≠ C342), R533 (= R370), E869 (= E712), L870 (≠ T713)
- binding glycerol: P416 (≠ E256), Y535 (≠ P372), Y622 (≠ W452), W683 (≠ I506), G696 (≠ H519), G697 (= G520), E869 (= E712), K884 (≠ S727), V889 (= V732), R890 (= R733), Y892 (≠ H735)
- binding magnesium ion: E899 (≠ P742), E903 (≠ A746)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G419 (= G259), T420 (≠ G260), F421 (= F261), G422 (= G262), R533 (= R370), W650 (≠ T477), H653 (≠ I480), G654 (= G481), Q655 (vs. gap), G656 (= G482), S695 (= S518), G696 (≠ H519), Q700 (≠ V523), Q701 (≠ T524), C799 (≠ I639), N800 (≠ H640), T804 (≠ V644), Q807 (= Q647), S865 (≠ R708), G866 (= G709), V867 (= V710), G868 (= G711), E869 (= E712)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
29% identity, 97% coverage: 14:748/756 of query aligns to 177:905/907 of 1sijA
- active site: I390 (≠ Q230), F425 (≠ T265), R501 (vs. gap), F505 (≠ C342), R533 (= R370), E869 (= E712), L870 (≠ T713)
- binding arsenite: Y535 (≠ P372), G696 (≠ H519), G697 (= G520), E869 (= E712)
- binding magnesium ion: E899 (≠ P742), E903 (≠ A746)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ G260), F421 (= F261), G422 (= G262), R533 (= R370), H653 (≠ I480), G654 (= G481), Q655 (vs. gap), G656 (= G482), S695 (= S518), G696 (≠ H519), S698 (= S521), Q700 (≠ V523), Q701 (≠ T524), C799 (≠ I639), N800 (≠ H640), T804 (≠ V644), Q807 (= Q647), S865 (≠ R708), G866 (= G709), V867 (= V710), G868 (= G711), E869 (= E712)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 99, 100, 101, 103, 137, 139
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139
Q46509 Aldehyde oxidoreductase; Molybdenum iron sulfur protein; EC 1.2.99.7 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
29% identity, 97% coverage: 14:748/756 of query aligns to 177:905/907 of Q46509
Sites not aligning to the query:
- 40 binding
- 45 binding
- 48 binding
- 60 binding
- 100 binding
- 103 binding
- 137 binding
- 139 binding
4zohA Crystal structure of glyceraldehyde oxidoreductase (see paper)
27% identity, 96% coverage: 13:740/756 of query aligns to 3:696/701 of 4zohA
- active site: Q186 (= Q230), I219 (≠ T265), V298 (≠ C342), S300 (≠ F344), M304 (≠ D348), R332 (= R370), E668 (= E712), A669 (≠ T713)
- binding pterin cytosine dinucleotide: G213 (= G259), A214 (≠ G260), F215 (= F261), R332 (= R370), H442 (≠ D479), G443 (≠ I480), Q444 (≠ G481), D446 (≠ S483), W482 (≠ H519), S484 (= S521), T486 (≠ V523), V487 (≠ T524), I594 (= I639), N595 (≠ H640), L598 (≠ Y643), Q602 (= Q647), K664 (≠ R708), G665 (= G709), I666 (≠ V710), G667 (= G711), E668 (= E712)
P19913 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Hydrogenophaga pseudoflava (Pseudomonas carboxydoflava) (see paper)
28% identity, 96% coverage: 26:751/756 of query aligns to 31:799/803 of P19913
- R384 (= R370) modified: 4-hydroxyarginine
1ffvB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
28% identity, 96% coverage: 26:751/756 of query aligns to 25:793/797 of 1ffvB
- active site: Q231 (= Q230), V266 (≠ T265), P343 (= P335), I349 (≠ M341), R378 (= R370), C379 (≠ A371), E751 (= E712), S752 (≠ T713)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G260 (= G259), G261 (= G260), F262 (= F261), G263 (= G262), A376 (= A368), R378 (= R370), C379 (≠ A371), Q516 (≠ I480), G517 (= G481), Q518 (vs. gap), H520 (≠ S483), T523 (≠ S486), Y556 (≠ H519), G557 (= G520), S558 (= S521), S560 (≠ V523), T561 (= T524), C674 (≠ A635), I678 (= I639), I683 (≠ V644), Q686 (= Q647), K747 (≠ R708), G748 (= G709), V749 (= V710), A750 (≠ G711), E751 (= E712)
1ffuB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
28% identity, 96% coverage: 26:751/756 of query aligns to 25:793/797 of 1ffuB
- active site: Q231 (= Q230), V266 (≠ T265), P343 (= P335), I349 (≠ M341), R378 (= R370), C379 (≠ A371), E751 (= E712), S752 (≠ T713)
- binding cytidine-5'-diphosphate: Q518 (vs. gap), H520 (≠ S483), T523 (≠ S486), S558 (= S521), S560 (≠ V523), T561 (= T524), C674 (≠ A635), T676 (≠ K637), I678 (= I639), I683 (≠ V644), K747 (≠ R708), G748 (= G709), V749 (= V710), A750 (≠ G711)
Query Sequence
>GFF1600 FitnessBrowser__Phaeo:GFF1600
MALDQRKTDFTQVGTRPNRPDGLDKVTGKARFGADATAPGMLFGAILRSPHAHARIKQID
TSKAEALADVKAIVTRADFSDAIKPAPGLEGEQWNVLENVMAGDTALYDGHAIAAVAATS
ALAARDALKLIEVEYEVLPHVTDVDKAMAQDAPVIREGAADYSVPEGMHPNVVRYHESGH
GDVEAGFAKADLVVEEHFVTEATHQGYIEPHACLAQLGQDGKGELWCCTQGHWYVQKNCA
ALLGIETSQLRVTASEIGGGFGGKTTVFIEPVALALSRKSNRPVKLVMSRPEVFRATGPT
ASTSMDIKIGMTADGIITAAQGTFRLQGGAFPGAPADMTAMCAFAPYDLQHVQQVGYDIM
SNRPKQAAYRAPGSPMAAYAVESVIDELCRKLDLDPVDVRLKNAAREGTRASYGPKFERI
GLVETLDAAKAHPHYSAPLKSGQGRGISCGFWFNHGGETSVSLSLSEDGTCQISVGTPDI
GGSRASMALMAAEVLGIPYESIRVTIADTATLGYNDVSHGSRVTYASGLATIKAAEDAVA
KLSKRAAAKWGIPEDAVKWEDGHAVPSGPNAGNFDPLPLAEITRDMGQTGGPISGHFEAT
PEGAGVSFATHIVDAEVDPETGKTAVTRYTVIQDAGKAIHPTYVEGQFQGGAAQGIGWAL
NEEYIYGEDGRLQNAVFLDYRIPVASDLPMIDTVIVEVPNPGHPFGVRGVGETSICPPLA
AIANAVSAAAGVRLHALPMSPPRILAALDQQRANNG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory