SitesBLAST
Comparing GFF1605 FitnessBrowser__WCS417:GFF1605 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
75% identity, 98% coverage: 1:336/344 of query aligns to 1:316/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), T13 (= T13), G14 (= G14), S15 (= S15), F16 (= F16), S36 (= S36), R37 (= R37), D38 (= D38), K41 (= K41), D60 (= D60), V61 (= V61), A80 (= A80), A81 (= A81), A82 (= A82), K84 (= K84), T99 (= T99), L122 (= L122), K138 (= K138), Y164 (= Y164)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
68% identity, 96% coverage: 2:332/344 of query aligns to 11:340/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G11), T22 (= T13), G23 (= G14), S24 (= S15), F25 (= F16), S45 (= S36), R46 (= R37), D47 (= D38), K50 (= K41), D69 (= D60), V70 (= V61), A89 (= A80), A90 (= A81), A91 (= A82), K93 (= K84), L131 (= L122), T133 (= T124), K147 (= K138), Y173 (= Y164)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (= Q85), V95 (= V86), K135 (= K126), N175 (= N166), S182 (= S173), V183 (= V174), L186 (= L177), T198 (= T189), T200 (= T191), M204 (= M195), V240 (= V231), R263 (= R255), E266 (= E258), Y278 (≠ M270), S313 (≠ T305), Y314 (≠ E306), E315 (≠ D307), Y316 (= Y308), N320 (= N312)
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
68% identity, 96% coverage: 2:332/344 of query aligns to 11:340/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K84), Q94 (= Q85), N175 (= N166), S179 (= S170), R180 (= R171), S182 (= S173), V183 (= V174), L186 (= L177), T198 (= T189), I199 (≠ L190), T200 (= T191), M204 (= M195), R206 (= R197), V240 (= V231), R263 (= R255), E266 (= E258)
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
64% identity, 96% coverage: 2:332/344 of query aligns to 3:312/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), T14 (= T13), G15 (= G14), F17 (= F16), S37 (= S36), R38 (= R37), D39 (= D38), K42 (= K41), D61 (= D60), V62 (= V61), R63 (= R62), A81 (= A80), A82 (= A81), A83 (= A82), K85 (= K84), S124 (= S123), T125 (= T124), K139 (= K138), Y165 (= Y164), G166 (= G165)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
56% identity, 96% coverage: 2:332/344 of query aligns to 1:267/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G11), T12 (= T13), G13 (= G14), S14 (= S15), F15 (= F16), S35 (= S36), R36 (= R37), D37 (= D38), K40 (= K41), D59 (= D60), V60 (= V61), A80 (= A81), A81 (= A82), K83 (= K84), L121 (= L122), T123 (= T124), K137 (= K138), Y163 (= Y164), G164 (= G165)
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
39% identity, 92% coverage: 1:316/344 of query aligns to 3:319/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K84), S176 (= S173), V177 (= V174), T195 (= T191), M199 (= M195), R201 (= R197), M235 (≠ V231), R254 (= R255), E257 (= E258)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (= T13), G16 (= G14), S17 (= S15), F18 (= F16), S39 (= S36), R40 (= R37), D41 (= D38), K44 (= K41), D63 (= D60), V64 (= V61), A83 (= A80), A84 (= A81), A85 (= A82), K87 (= K84), L125 (= L122), S126 (= S123), Y137 (≠ M134), K141 (= K138), Y167 (= Y164), G168 (= G165), V170 (= V167)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
39% identity, 92% coverage: 1:316/344 of query aligns to 3:319/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (= T13), G16 (= G14), S17 (= S15), F18 (= F16), R40 (= R37), D41 (= D38), K44 (= K41), D63 (= D60), V64 (= V61), A83 (= A80), A84 (= A81), A85 (= A82), K87 (= K84), L125 (= L122), S126 (= S123), K141 (= K138), Y167 (= Y164), G168 (= G165), V170 (= V167), R174 (= R171)
- binding uridine-5'-diphosphate-glucose: K87 (= K84), T127 (= T124), K129 (= K126), Y137 (≠ M134), N169 (= N166), S176 (= S173), V177 (= V174), P193 (≠ T189), T195 (= T191), M199 (= M195), R201 (= R197), M235 (≠ V231), R254 (= R255), E257 (= E258)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
39% identity, 92% coverage: 1:316/344 of query aligns to 3:319/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (= T13), G16 (= G14), S17 (= S15), F18 (= F16), R40 (= R37), D41 (= D38), K44 (= K41), D63 (= D60), V64 (= V61), A84 (= A81), A85 (= A82), K87 (= K84), S126 (= S123), Y137 (≠ M134), K141 (= K138), Y167 (= Y164), G168 (= G165), V170 (= V167), S173 (= S170), R174 (= R171)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K84), D128 (= D125), K129 (= K126), N169 (= N166), G175 (= G172), S176 (= S173), V177 (= V174), P193 (≠ T189), I194 (≠ L190), M199 (= M195), R201 (= R197), M235 (≠ V231), R254 (= R255), E257 (= E258)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
39% identity, 92% coverage: 1:316/344 of query aligns to 3:319/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), T15 (= T13), G16 (= G14), S17 (= S15), F18 (= F16), S39 (= S36), R40 (= R37), D41 (= D38), K44 (= K41), D63 (= D60), V64 (= V61), A83 (= A80), A84 (= A81), A85 (= A82), K87 (= K84), T102 (= T99), L125 (= L122), S126 (= S123), T127 (= T124), Y137 (≠ M134), K141 (= K138), Y167 (= Y164), G168 (= G165), V170 (= V167), S173 (= S170), R174 (= R171)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K84), T127 (= T124), D128 (= D125), K129 (= K126), Y137 (≠ M134), N169 (= N166), S176 (= S173), V177 (= V174), P193 (≠ T189), T195 (= T191), M199 (= M195), R201 (= R197), M235 (≠ V231), R254 (= R255), E257 (= E258)
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
39% identity, 92% coverage: 1:316/344 of query aligns to 1:317/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), T13 (= T13), G14 (= G14), S15 (= S15), F16 (= F16), S37 (= S36), R38 (= R37), D39 (= D38), K42 (= K41), D61 (= D60), V62 (= V61), A81 (= A80), A82 (= A81), A83 (= A82), K85 (= K84), T100 (= T99), L123 (= L122), S124 (= S123), K139 (= K138), Y165 (= Y164), G166 (= G165), V168 (= V167), S171 (= S170), R172 (= R171)
- binding uridine-5'-diphosphate: K127 (= K126), N167 (= N166), V175 (= V174), P191 (≠ T189), I192 (≠ L190), T193 (= T191), M197 (= M195), R199 (= R197), M233 (≠ V231), R252 (= R255)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
39% identity, 92% coverage: 1:316/344 of query aligns to 7:323/333 of O25511
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
38% identity, 83% coverage: 1:287/344 of query aligns to 2:294/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), T14 (= T13), G15 (= G14), T16 (≠ S15), I17 (≠ F16), S37 (= S36), R38 (= R37), S39 (≠ D38), D63 (= D60), I64 (≠ V61), V83 (≠ A80), A84 (= A81), K87 (= K84), T125 (≠ L122), S127 (≠ T124), Y137 (≠ M134), K141 (= K138), F167 (≠ Y164), V170 (= V167), S173 (= S170), R174 (= R171)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K84), H88 (≠ Q85), S127 (≠ T124), N128 (≠ D125), Y137 (≠ M134), N169 (= N166), S176 (= S173), V177 (= V174), L180 (= L177), T192 (= T189), T194 (= T191), M198 (= M195), R200 (= R197), L234 (≠ V231), E265 (= E258)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
36% identity, 82% coverage: 2:284/344 of query aligns to 3:265/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (≠ T13), G15 (= G14), S16 (= S15), L17 (≠ F16), R36 (= R37), D37 (= D38), D59 (= D60), I60 (≠ V61), A81 (= A80), A82 (= A81), A83 (= A82), K85 (= K84), V128 (≠ L122), Y140 (≠ M134), K144 (= K138), Y168 (= Y164), G169 (= G165), V171 (= V167)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
36% identity, 78% coverage: 5:271/344 of query aligns to 25:292/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G11), G34 (= G14), T35 (≠ S15), I36 (≠ F16), D56 (≠ S36), H57 (≠ R37), S82 (≠ Y57), I83 (= I58), A104 (= A80), A105 (= A81), A106 (= A82), K108 (= K84), N123 (≠ T99), I146 (≠ L122), K162 (= K138), F184 (≠ Y164), G185 (= G165), N186 (= N166), V187 (= V167), S190 (= S170), S191 (≠ R171)
- binding uridine-5'-diphosphate: K150 (= K126), N186 (= N166), S193 (= S173), V194 (= V174), T209 (= T189), L210 (= L190), T211 (= T191), I215 (≠ M195), R217 (= R197), E279 (= E258)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
36% identity, 78% coverage: 5:271/344 of query aligns to 25:292/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G11), G34 (= G14), T35 (≠ S15), I36 (≠ F16), D56 (≠ S36), H57 (≠ R37), S82 (≠ Y57), I83 (= I58), A104 (= A80), A105 (= A81), A106 (= A82), K108 (= K84), N123 (≠ T99), I146 (≠ L122), K162 (= K138), F184 (≠ Y164), G185 (= G165), N186 (= N166), V187 (= V167), S190 (= S170), S191 (≠ R171)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K84), H109 (≠ Q85), T148 (= T124), G185 (= G165), N186 (= N166), S193 (= S173), V194 (= V174), T209 (= T189), L210 (= L190), T211 (= T191), I215 (≠ M195), R217 (= R197), R276 (= R255), E279 (= E258)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
29% identity, 66% coverage: 3:229/344 of query aligns to 29:259/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G14), S41 (= S15), I42 (≠ F16), D62 (vs. gap), I63 (vs. gap), D92 (vs. gap), I93 (vs. gap), L114 (≠ A80), S115 (≠ A81), A116 (= A82), K118 (= K84), V158 (≠ L122), D161 (= D125), K174 (= K138), V198 (= V167), S201 (= S170)
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
29% identity, 66% coverage: 3:228/344 of query aligns to 27:242/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G14), S39 (= S15), I40 (≠ F16), D60 (vs. gap), I61 (vs. gap), L89 (vs. gap), D90 (vs. gap), I91 (vs. gap), L112 (≠ A80), S113 (≠ A81), A114 (= A82), K116 (= K84), D159 (= D125), K172 (= K138), N195 (= N166), V196 (= V167), S199 (= S170)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
25% identity, 71% coverage: 6:249/344 of query aligns to 2:262/309 of 4zrnA
- active site: T117 (= T124), G119 (≠ K126), A120 (= A127), Y143 (≠ M134), K147 (= K138), Y181 (vs. gap), G185 (≠ S173)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), F11 (≠ S15), I12 (≠ F16), D31 (≠ F35), N32 (≠ S36), S34 (≠ D38), S35 (≠ E39), G36 (≠ K40), S51 (≠ D60), I52 (≠ V61), L73 (≠ A80), A74 (= A81), A75 (= A82), T92 (= T99), S115 (≠ L122), S116 (= S123), Y143 (≠ M134), K147 (= K138), Y170 (= Y164), V173 (= V167)
- binding uridine-5'-diphosphate-glucose: T117 (= T124), G119 (≠ K126), A120 (= A127), Y143 (≠ M134), N172 (= N166), G185 (≠ S173), V186 (= V174), H201 (≠ T189), F203 (vs. gap), Y208 (≠ M195), R210 (= R197), V244 (= V231)
Sites not aligning to the query:
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
27% identity, 75% coverage: 7:264/344 of query aligns to 3:283/322 of 1r66A
- active site: T127 (= T124), D128 (= D125), E129 (≠ K126), Y151 (≠ M134), K155 (= K138)
- binding nicotinamide-adenine-dinucleotide: G10 (= G14), F11 (≠ S15), I12 (≠ F16), D37 (= D38), S38 (≠ E39), L39 (≠ K40), T40 (≠ K41), G43 (≠ D44), D63 (= D60), I64 (≠ V61), F83 (≠ A80), A84 (= A81), A85 (= A82), S87 (≠ K84), T102 (= T99), V125 (≠ L122), S126 (= S123), Y151 (≠ M134), K155 (= K138), N181 (≠ R163)
- binding thymidine-5'-diphosphate: H88 (≠ Q85), E129 (≠ K126), N180 (≠ T162), K190 (≠ S173), L191 (≠ V174), P206 (≠ T189), Y208 (vs. gap), R215 (= R197), N250 (≠ V231), R274 (= R255), H277 (≠ E258)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
26% identity, 75% coverage: 7:264/344 of query aligns to 3:283/322 of 1r6dA
- active site: T127 (= T124), N128 (≠ D125), Q129 (≠ K126), Y151 (≠ M134), K155 (= K138)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ K84), H88 (≠ Q85), T127 (= T124), N128 (≠ D125), Q129 (≠ K126), Y151 (≠ M134), N180 (≠ T162), K190 (≠ S173), L191 (≠ V174), P206 (≠ T189), Y208 (vs. gap), R215 (= R197), N250 (≠ V231), R274 (= R255), H277 (≠ E258), Y281 (≠ E262)
- binding nicotinamide-adenine-dinucleotide: G10 (= G14), F11 (≠ S15), I12 (≠ F16), D37 (= D38), S38 (≠ E39), L39 (≠ K40), T40 (≠ K41), A42 (≠ D43), G43 (≠ D44), D63 (= D60), I64 (≠ V61), F83 (≠ A80), A84 (= A81), A85 (= A82), S87 (≠ K84), T102 (= T99), V125 (≠ L122), S126 (= S123), Y151 (≠ M134), K155 (= K138), N181 (≠ R163)
Query Sequence
>GFF1605 FitnessBrowser__WCS417:GFF1605
MFSGKTLLITGGTGSFGNAVLKRFLDSGIAEIRIFSRDEKKQDDMRKRYADTKLKFYIGD
VRDYQSVLNATRGVDYIFHAAALKQVPSCEFHPMEAVKTNVIGTENVLEAAIQNSVKRVV
CLSTDKAVYPINAMGISKAMMEKVMIAKSRNVDDAKTVICGTRYGNVMASRGSVIPLFIE
QIRAGNALTLTDPSMTRFMMTLADAVDLVLYAFEHGRNGDLFVQKAPAATVETLAKALTA
MVGKPEHPIQVIGTRHGEKLFEALLSREEMACAEDKGDYYRIPPDLRDLNYSKFVEQGEE
KISRTEDYNSHNTERLDVAGMQRLLLKLEFMKAIQRGELATPEE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory