SitesBLAST
Comparing GFF1617 FitnessBrowser__Phaeo:GFF1617 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
53% identity, 97% coverage: 12:348/348 of query aligns to 4:342/350 of Q88H32
- R45 (= R53) binding
- K69 (= K77) binding
- T84 (= T92) binding
- R112 (= R120) binding ; binding
- AQ 139:140 (= AQ 147:148) binding
- D161 (= D169) binding
- T202 (= T209) binding
- VGGD 225:228 (≠ IGGD 232:235) binding
- D228 (= D235) binding
- K232 (= K239) binding
- S293 (= S300) binding
- V294 (= V301) binding
- K331 (≠ R337) binding
1u7hA Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida (see paper)
53% identity, 97% coverage: 12:348/348 of query aligns to 3:341/341 of 1u7hA
- active site: E55 (= E64), D227 (= D235)
- binding nicotinamide-adenine-dinucleotide: T83 (= T92), R111 (= R120), T112 (= T121), G137 (= G146), A138 (= A147), Q139 (= Q148), D160 (= D169), T161 (≠ V170), V200 (≠ C208), T201 (= T209), A202 (= A210), I209 (= I217), V224 (≠ I232), G225 (= G233), D227 (= D235), K231 (= K239), S292 (= S300), V293 (= V301), G294 (= G302)
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
54% identity, 95% coverage: 12:340/348 of query aligns to 3:333/340 of 1x7dA
- active site: E55 (= E64), D227 (= D235)
- binding nicotinamide-adenine-dinucleotide: T83 (= T92), R111 (= R120), T112 (= T121), G137 (= G146), A138 (= A147), Q139 (= Q148), D160 (= D169), T161 (≠ V170), V200 (≠ C208), T201 (= T209), A202 (= A210), I209 (= I217), V224 (≠ I232), G225 (= G233), D227 (= D235), K231 (= K239), S292 (= S300), V293 (= V301), G294 (= G302)
- binding L-ornithine: R44 (= R53), V53 (= V62), E55 (= E64), M57 (= M66), K68 (= K77), V70 (= V79), N71 (= N80), G72 (= G81), R111 (= R120), D227 (= D235), V293 (= V301)
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
33% identity, 82% coverage: 31:316/348 of query aligns to 17:306/322 of O28608
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
33% identity, 82% coverage: 31:317/348 of query aligns to 17:307/320 of 1omoA
- active site: R52 (≠ E64), D219 (= D235)
- binding nicotinamide-adenine-dinucleotide: T109 (= T121), G134 (= G146), T135 (≠ A147), Q136 (= Q148), Y156 (= Y168), D157 (= D169), V158 (= V170), R159 (≠ D171), T195 (≠ C208), P196 (≠ T209), G217 (= G233), D219 (= D235), K223 (= K239), S290 (= S300), T291 (≠ V301), G292 (= G302)
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
30% identity, 80% coverage: 31:307/348 of query aligns to 15:303/325 of 6t3eB
- binding 1,4-dihydronicotinamide adenine dinucleotide: S82 (≠ T92), T111 (= T121), G136 (= G146), V137 (≠ A147), Q138 (= Q148), D159 (= D169), I160 (≠ V170), A199 (≠ C208), T200 (= T209), T201 (≠ A210), A202 (≠ D211), V206 (≠ I217), V221 (≠ I232), G222 (= G233), W223 (vs. gap), S296 (= S300), V297 (= V301), G298 (= G302)
- binding proline: R39 (≠ H57), M54 (= M66), K67 (= K77), R110 (= R120)
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
32% identity, 81% coverage: 61:342/348 of query aligns to 60:343/344 of 5yu4A
- binding 2,4-diaminobutyric acid: E63 (= E64), K77 (= K77), R121 (= R120), T302 (≠ V301), G303 (= G302)
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ G81), T93 (= T92), I94 (≠ V93), R121 (= R120), T122 (= T121), G147 (= G146), A148 (= A147), Q149 (= Q148), D170 (= D169), T171 (≠ V170), H175 (≠ A174), A208 (≠ T207), T209 (≠ C208), S210 (≠ T209), V211 (≠ A210), V218 (≠ I217), V233 (≠ I232), A235 (≠ G234), S301 (= S300), T302 (≠ V301), G303 (= G302)
5yu3A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
32% identity, 81% coverage: 61:342/348 of query aligns to 60:343/344 of 5yu3A
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ G81), T93 (= T92), I94 (≠ V93), T122 (= T121), G147 (= G146), A148 (= A147), Q149 (= Q148), D170 (= D169), T171 (≠ V170), A208 (≠ T207), T209 (≠ C208), S210 (≠ T209), V211 (≠ A210), V233 (≠ I232), A235 (≠ G234), S301 (= S300), T302 (≠ V301), G303 (= G302)
- binding proline: M65 (= M66), K77 (= K77), R121 (= R120)
5gziA Cyclodeaminase_pa
32% identity, 81% coverage: 61:342/348 of query aligns to 64:347/354 of 5gziA
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ G81), T97 (= T92), R125 (= R120), T126 (= T121), G151 (= G146), A152 (= A147), Q153 (= Q148), D174 (= D169), T175 (≠ V170), H179 (≠ A174), A212 (≠ T207), T213 (≠ C208), S214 (≠ T209), V215 (≠ A210), V237 (≠ I232), G238 (= G233), A239 (≠ G234), S305 (= S300), T306 (≠ V301), G307 (= G302)
- binding (2S)-piperidine-2-carboxylic acid: K81 (= K77), R125 (= R120), A239 (≠ G234), T306 (≠ V301), G307 (= G302)
Sites not aligning to the query:
5gzlA Cyclodeaminase_pa
32% identity, 81% coverage: 61:342/348 of query aligns to 64:347/357 of 5gzlA
- binding lysine: I65 (≠ V62), E67 (= E64), D240 (= D235), R267 (≠ V262), E268 (= E263)
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ G81), T97 (= T92), I98 (≠ V93), T126 (= T121), G151 (= G146), A152 (= A147), Q153 (= Q148), D174 (= D169), T175 (≠ V170), H179 (≠ A174), A212 (≠ T207), T213 (≠ C208), S214 (≠ T209), V222 (≠ I217), V237 (≠ I232), G238 (= G233), A239 (≠ G234), D240 (= D235), K244 (= K239), S305 (= S300), T306 (≠ V301), G307 (= G302)
Sites not aligning to the query:
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
31% identity, 73% coverage: 75:329/348 of query aligns to 67:322/322 of 6rqaB
- binding Tb-Xo4: N76 (≠ K84)
- binding nicotinamide-adenine-dinucleotide: T113 (= T121), G138 (= G146), Q140 (= Q148), P162 (≠ V170), H163 (≠ D171), I199 (≠ A210), T200 (≠ D211), S201 (≠ K212), S202 (≠ Q213), M221 (≠ I232), G222 (= G233), D224 (= D235), K228 (= K239), G293 (≠ S300), T294 (≠ V301), G295 (= G302)
Sites not aligning to the query:
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
31% identity, 73% coverage: 75:329/348 of query aligns to 67:322/322 of 6rqaA
- binding nicotinamide-adenine-dinucleotide: H85 (≠ V93), T113 (= T121), G138 (= G146), H139 (≠ A147), Q140 (= Q148), N161 (≠ D169), P162 (≠ V170), H163 (≠ D171), M166 (≠ A174), I199 (≠ A210), T200 (≠ D211), S201 (≠ K212), S202 (≠ Q213), M221 (≠ I232), G222 (= G233), D224 (= D235), K228 (= K239), G293 (≠ S300)
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
31% identity, 73% coverage: 75:329/348 of query aligns to 65:320/320 of A1B8Z0
4mp6A Staphyloferrin b precursor biosynthetic enzyme sbnb bound to citrate and NAD+ (see paper)
24% identity, 76% coverage: 66:329/348 of query aligns to 62:333/334 of 4mp6A
- active site: M236 (≠ T240)
- binding nicotinamide-adenine-dinucleotide: R92 (≠ T92), R120 (= R120), T121 (= T121), G146 (= G146), L147 (vs. gap), I148 (vs. gap), D170 (= D169), Q171 (≠ V170), C211 (= C208), T212 (= T209), V213 (≠ A210), I233 (= I232), G306 (= G302)
Sites not aligning to the query:
4m54A The structure of the staphyloferrin b precursor biosynthetic enzyme sbnb bound to n-(1-amino-1-carboxyl-2-ethyl)-glutamic acid and nadh (see paper)
25% identity, 76% coverage: 66:329/348 of query aligns to 57:309/310 of 4m54A
- active site: M231 (≠ T240)
- binding N-[(2S)-2-amino-2-carboxyethyl]-L-glutamic acid: M57 (= M66), K71 (= K77), I73 (≠ V79), R87 (≠ T92), R115 (= R120)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R87 (≠ T92), T116 (= T121), G141 (= G146), L142 (vs. gap), I143 (vs. gap), D165 (= D169), Q166 (≠ V170), T207 (= T209), T209 (≠ D211), I228 (= I232)
Sites not aligning to the query:
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
30% identity, 63% coverage: 98:316/348 of query aligns to 88:299/303 of 4bv9A
- active site: S220 (≠ D235)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T111 (= T121), G134 (= G144), G136 (= G146), V137 (≠ A147), Q138 (= Q148), N159 (≠ D169), R160 (≠ V170), T161 (≠ D171), V195 (≠ C208), T196 (= T209), M197 (≠ A210), A198 (≠ D211), V217 (≠ I232), G218 (= G233), S283 (= S300), L284 (≠ V301), G285 (= G302)
- binding pyruvic acid: R110 (= R120)
Sites not aligning to the query:
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
30% identity, 63% coverage: 98:316/348 of query aligns to 87:298/303 of 4bvaA
- active site: S219 (≠ D235)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T106 (= T117), R109 (= R120), T110 (= T121), G135 (= G146), V136 (≠ A147), Q137 (= Q148), N158 (≠ D169), R159 (≠ V170), T160 (≠ D171), N163 (≠ A174), V194 (≠ C208), T195 (= T209), M196 (≠ A210), A197 (≠ D211), V216 (≠ I232), S282 (= S300), L283 (≠ V301), G284 (= G302)
- binding 3,5,3'triiodothyronine: S219 (≠ D235), R220 (≠ C236), W223 (≠ K239), E247 (= E263)
Sites not aligning to the query:
4mpdA Staphyloferrin b precursor biosynthetic enzyme sbnb bound a- ketoglutarate and NAD+ (see paper)
24% identity, 73% coverage: 75:329/348 of query aligns to 62:317/318 of 4mpdA
- active site: M224 (≠ T240)
- binding 2-oxoglutaric acid: K64 (= K77), I66 (≠ V79), R80 (≠ T92), M289 (≠ V301)
- binding nicotinamide-adenine-dinucleotide (acidic form): R80 (≠ T92), R108 (= R120), T109 (= T121), G134 (= G146), I136 (vs. gap), D158 (= D169), Q159 (≠ V170), F160 (≠ D171), T200 (= T209), V201 (≠ A210), I221 (= I232)
Sites not aligning to the query:
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
28% identity, 63% coverage: 98:316/348 of query aligns to 96:307/312 of 2i99A
- active site: S228 (≠ D235)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R118 (= R120), T119 (= T121), G142 (= G144), A143 (≠ N145), G144 (= G146), V145 (≠ A147), Q146 (= Q148), N167 (≠ D169), R168 (≠ V170), T169 (≠ D171), V203 (≠ C208), T204 (= T209), L205 (≠ A210), A206 (≠ D211), V225 (≠ I232), G226 (= G233), S291 (= S300), L292 (≠ V301), G293 (= G302)
Sites not aligning to the query:
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
28% identity, 63% coverage: 98:316/348 of query aligns to 97:308/314 of Q14894
Query Sequence
>GFF1617 FitnessBrowser__Phaeo:GFF1617
MTQPSDKALVPFVSVDNMMRLIHHVGIDTVMKDLATYIEEDFKRWELFDKTPRVASHSDV
GVIELMPTSDGEAYGFKYVNGHPKNTSEGLQTVTAFGLLADVYTGYPVLLTEMTILTALR
TAATSAMVAKHLAPKGATTMAMIGNGAQSEFQSLAMQAICGLKSVRLYDVDPAATAKCAA
NLAGTGLAVVSCKTPEEAIEGAQILTTCTADKQYATILTDNMVGSGVHINAIGGDCPGKT
ELAPGILSRSDVFVEFPPQTRVEGEIQQMPEDFEVTELWQVILGQKPGRRDDKQITLFDS
VGFAIEDFSALRYIRDRIKDTDFFLELDMLADPDDPRDLFGMVQRAKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory