SitesBLAST
Comparing GFF1630 FitnessBrowser__Phaeo:GFF1630 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
41% identity, 99% coverage: 3:229/229 of query aligns to 6:239/240 of 1ji0A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
33% identity, 99% coverage: 3:228/229 of query aligns to 2:235/240 of 6mjpA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
35% identity, 98% coverage: 4:228/229 of query aligns to 3:235/235 of 6mhzA
- binding adp orthovanadate: Y12 (= Y13), N37 (= N38), G38 (= G39), G40 (= G41), K41 (= K42), T42 (≠ S43), T43 (= T44), Q84 (≠ E85), S136 (= S130), S138 (= S132), G139 (= G133), G140 (= G134), E162 (= E156), G166 (= G160), H194 (≠ K189)
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
35% identity, 98% coverage: 4:228/229 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
35% identity, 98% coverage: 4:228/229 of query aligns to 3:235/238 of 6s8gA
- binding phosphoaminophosphonic acid-adenylate ester: Y12 (= Y13), R15 (≠ S16), N37 (= N38), G40 (= G41), K41 (= K42), T42 (≠ S43), T43 (= T44), Q84 (≠ E85), S136 (= S130), S138 (= S132), E141 (= E135)
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
35% identity, 92% coverage: 4:213/229 of query aligns to 3:218/233 of 6b8bA
- binding adenosine-5'-diphosphate: Y12 (= Y13), R15 (≠ S16), V17 (≠ A18), G38 (= G39), G40 (= G41), K41 (= K42), T42 (≠ S43), T43 (= T44)
- binding (3s,5s,7s)-N-{7-[(3-O-carbamoyl-6-deoxy-5-methyl-4-O-methyl-beta-D-gulopyranosyl)oxy]-4-hydroxy-8-methyl-2-oxo-2H-1-benzopyran-3-yl}tricyclo[3.3.1.1~3,7~]decane-1-carboxamide: F89 (= F90), R90 (≠ A91), R91 (≠ P92)
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
35% identity, 92% coverage: 4:213/229 of query aligns to 3:218/234 of 6b89A
- binding adenosine-5'-diphosphate: Y12 (= Y13), R15 (≠ S16), V17 (≠ A18), N37 (= N38), G38 (= G39), G40 (= G41), K41 (= K42), T42 (≠ S43), T43 (= T44)
- binding magnesium ion: T42 (≠ S43), Q84 (≠ E85)
- binding novobiocin: L71 (≠ S72), H72 (= H73), P83 (= P84), A86 (≠ R87), S87 (≠ R88), F89 (= F90), R90 (≠ A91), R91 (≠ P92), L92 (= L93), V101 (≠ A102), Q135 (≠ S129), R149 (= R143)
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
35% identity, 92% coverage: 4:213/229 of query aligns to 3:218/234 of 4p31A
6mbnA Lptb e163q in complex with atp (see paper)
35% identity, 98% coverage: 4:228/229 of query aligns to 4:236/241 of 6mbnA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 93% coverage: 1:213/229 of query aligns to 2:232/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 93% coverage: 1:213/229 of query aligns to 2:232/254 of 1g6hA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
28% identity, 93% coverage: 3:214/229 of query aligns to 4:219/285 of 4yerA
- binding adenosine-5'-diphosphate: F14 (≠ Y13), F17 (≠ S16), N39 (= N38), G40 (= G39), G42 (= G41), K43 (= K42), T44 (≠ S43), T45 (= T44), T135 (≠ S130), F136 (≠ L131), S137 (= S132)
Q8IUA7 ATP-binding cassette sub-family A member 9; EC 7.6.2.- from Homo sapiens (Human) (see 2 papers)
29% identity, 92% coverage: 4:214/229 of query aligns to 481:699/1624 of Q8IUA7
Sites not aligning to the query:
- 353 R → H: in dbSNP:rs1860447
- 949 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 1306 K → T: in dbSNP:rs2302294
O95477 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; Cholesterol efflux regulatory protein; EC 7.6.2.1 from Homo sapiens (Human) (see 35 papers)
29% identity, 97% coverage: 4:226/229 of query aligns to 899:1126/2261 of O95477
- D917 (≠ F20) to Y: in a colorectal cancer sample; somatic mutation
- T929 (≠ V32) to I: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane
- N935 (= N38) to S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs28937313
- K939 (= K42) mutation to M: Inhibits ATPase activity; when associated with M-1952. Decreases translocase activity; when associated with M-1952. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-1952.
- S1042 (≠ A140) modified: Phosphoserine; by PKA
- P1065 (= P163) natural variant: P -> S
- M1091 (≠ L191) to T: in FHA1; loss of localization to plasma membrane; decreased cholesterol efflux; decreased phospholipid efflux
- C1110 (≠ V210) modified: S-palmitoyl cysteine; mutation to S: Decreased palmitoylation; when associated with S-3, S-23 and S-1111.
- C1111 (≠ W211) modified: S-palmitoyl cysteine; mutation to S: Decreased palmitoylation; when associated with S-3, S-23 and S-1110.
Sites not aligning to the query:
- 3 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased cholesterol efflux. Decreased phospholipid efflux. Decreased palmitoylation; when associated with S-23, S-1110 and S-1111.
- 23 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased palmitoylation; when associated with S-3, S-1110 and S-1111.
- 74 I→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.; I→K: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-371.
- 75 modified: Disulfide link with 309
- 85 P → L: in FHA1; Alabama; dbSNP:rs145183203
- 98 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 100 S→C: Highly decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 210 E → D: in a colorectal cancer sample; somatic mutation
- 219 R → K: in dbSNP:rs2230806
- 230 R → C: in dbSNP:rs9282541
- 244 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 248 P → A: in dbSNP:rs142625938
- 255 A → T: in TGD; deficient cellular cholesterol efflux; dbSNP:rs758100110
- 304 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-308.
- 308 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-304.
- 309 modified: Disulfide link with 75
- 364 S → C: in dbSNP:rs775035559
- 371 I→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane. 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-74 or C-375.; I→E: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-74.
- 375 L→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.
- 399 V → A: in dbSNP:rs9282543
- 401 K → Q: in dbSNP:rs138487227
- 496 R → W: in dbSNP:rs147675550
- 568 K→A: 60-65% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane.
- 573 Y→F: No effect on phospholipid and cholesterol efflux and on localization to cell membrane.
- 581 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-584 and K-585.
- 583 F→K: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-590.
- 584 E→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-585.
- 585 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-584.
- 590 W → S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs137854496; W→E: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-583.
- 593 F→L: Moderately decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 638 R → Q: in dbSNP:rs374190304
- 771 V → M: in dbSNP:rs2066718
- 774 T → P: in dbSNP:rs35819696; natural variant: T -> S
- 776 K → N: in dbSNP:rs138880920
- 815 E → G: in dbSNP:rs145582736
- 825 V → I: in dbSNP:rs2066715
- 883 I → M: in dbSNP:rs2066714
- 1172 E → D: in dbSNP:rs33918808
- 1181 S → F: in dbSNP:rs76881554
- 1216 G → V: in dbSNP:rs562403512
- 1341 R → T: in dbSNP:rs147743782
- 1376 S → G: in dbSNP:rs145689805
- 1379 L → F: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1407 A → T: in a colorectal cancer sample; somatic mutation; dbSNP:rs189206655
- 1463 modified: Disulfide link with 1477
- 1477 modified: Disulfide link with 1463; C → R: in TGD; loss of interaction with APOE; unable to generate APOE-containing high density lipoproteins; moderately decreased protein abundance; moderately decreased ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs137854494
- 1512 T→M: Moderately decreased protein abundance. Does not affect ATPase activity. Moderately decreased phospholipid translocase activity.
- 1555 I → T: in dbSNP:rs1997618
- 1587 K → R: in dbSNP:rs2230808
- 1611 N → D: in FHA1; deficient cellular cholesterol efflux
- 1615 R → Q: in dbSNP:rs1251839800
- 1648 L → P: in dbSNP:rs1883024
- 1670 A → T: in dbSNP:rs1203589782
- 1680 R → Q: in dbSNP:rs150125857
- 1704 V → D: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1731 S → C: in dbSNP:rs760507032
- 1897 R → W: in FHA1; uncertain significance; dbSNP:rs760768125
- 1925 R → Q: in Scott syndrome; shows impaired trafficking of the mutant protein to the plasma membrane; dbSNP:rs142688906
- 1952 K→M: Inhibits ATPase activity; when associated with M-939. Decreases translocase activity; when associated with M-939. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-939.
- 2054 modified: Phosphoserine; by PKA
- 2081 R → W: in TGD; highly decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane; dbSNP:rs137854501
- 2109 A → T: in a colorectal cancer sample; somatic mutation
- 2150 P → L: in FHA1; moderately decreased protein abundance; does not affect ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs369098049
- 2163 natural variant: F -> S
- 2168 L → P: in dbSNP:rs2853577
- 2243 D → E: in dbSNP:rs34879708
- 2244 V → I: in dbSNP:rs144588452
7o12B Abc transporter nosdfy, amppnp-bound in gdn (see paper)
35% identity, 95% coverage: 4:221/229 of query aligns to 3:217/298 of 7o12B
P41233 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; EC 7.6.2.1 from Mus musculus (Mouse) (see paper)
29% identity, 97% coverage: 4:226/229 of query aligns to 899:1126/2261 of P41233
Sites not aligning to the query:
- 489 modified: carbohydrate, N-linked (GlcNAc...) asparagine
7tbwA The structure of atp-bound abca1 (see paper)
29% identity, 97% coverage: 4:226/229 of query aligns to 754:981/1928 of 7tbwA
- binding adenosine-5'-triphosphate: Y763 (= Y13), D765 (vs. gap), K768 (≠ S16), N790 (= N38), G791 (= G39), G793 (= G41), K794 (= K42), T795 (≠ S43), Q835 (≠ E85), Q887 (≠ S130), S889 (= S132), H944 (≠ K189)
- binding magnesium ion: Q835 (≠ E85), D912 (= D155), Q913 (≠ E156)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 1630, 1633, 1657, 1658, 1660, 1661, 1662, 1663, 1702, 1753, 1755, 1756, 1757, 1779, 1783, 1811
- binding cholesterol: 218, 219, 360, 367
- binding magnesium ion: 1662, 1702
7o17B Abc transporter nosdfy e154q, atp-bound in lipid nanodisc (see paper)
34% identity, 95% coverage: 4:221/229 of query aligns to 3:217/298 of 7o17B
- binding adenosine-5'-triphosphate: Y12 (= Y13), V17 (≠ A18), N37 (= N38), G38 (= G39), A39 (≠ M40), G40 (= G41), K41 (= K42), T42 (≠ S43), T43 (= T44), E80 (= E85), R123 (≠ Q126), T127 (≠ S130), S129 (= S132), K130 (≠ G133), G131 (= G134), M132 (≠ E135)
- binding magnesium ion: K41 (= K42), T42 (≠ S43)
Q8N139 ATP-binding cassette sub-family A member 6; EC 7.6.2.- from Homo sapiens (Human) (see 2 papers)
29% identity, 89% coverage: 4:207/229 of query aligns to 478:689/1617 of Q8N139
Sites not aligning to the query:
- 282 V → I: in dbSNP:rs4968839
- 875 M → I: in dbSNP:rs7212506
- 940 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 1322 N → S: in dbSNP:rs2302134
7roqA Alternative structure of human abca1
30% identity, 90% coverage: 21:226/229 of query aligns to 789:996/1831 of 7roqA
Sites not aligning to the query:
Query Sequence
>GFF1630 FitnessBrowser__Phaeo:GFF1630
MTLLSLKNVTASYGPSQALFGVELDIGEGEVVALMGRNGMGKSTTIKTICGMLPASEGTL
HFAGNDLRKLHSHKIARLGIGLVPEGRRCFAPLTVEENLRAAARPGPWDFAMVADLFPRL
AERRDQTASSLSGGEQQMLAIGRALMINPRLLILDEATEGLAPVVRQEIWAAIARLKRDS
GLSILVVDKTLRELAAVADRAVIVNKGATVWTGAMDALTPELKDRYLGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory