SitesBLAST
Comparing GFF1637 FitnessBrowser__Marino:GFF1637 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
6j39A Crystal structure of cmis2 with inhibitor (see paper)
26% identity, 85% coverage: 59:403/406 of query aligns to 17:354/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: M44 (≠ F93), P46 (≠ A95), N49 (≠ P98), R243 (≠ K301), Y252 (vs. gap), Y267 (≠ A318), R308 (= R358), R334 (≠ H384), I335 (≠ L385)
- binding flavin-adenine dinucleotide: V29 (= V78), D30 (≠ N79), P31 (= P80), E32 (≠ K81), K36 (≠ H85), A37 (≠ K86), S38 (≠ L87), V40 (≠ W89), S41 (≠ F90), A42 (= A91), G43 (≠ E92), M44 (≠ F93), A174 (≠ V220), A203 (= A252), W206 (≠ G255), I228 (≠ S276), Y252 (vs. gap), R308 (= R358), S333 (≠ G383), R334 (≠ H384), I335 (≠ L385), G336 (= G386), V337 (≠ W387), Q338 (≠ T388)
Sites not aligning to the query:
6j38A Crystal structure of cmis2 (see paper)
26% identity, 85% coverage: 59:403/406 of query aligns to 17:354/368 of 6j38A
- binding flavin-adenine dinucleotide: V29 (= V78), D30 (≠ N79), P31 (= P80), K36 (≠ H85), A37 (≠ K86), S38 (≠ L87), S41 (≠ F90), A42 (= A91), G43 (≠ E92), M44 (≠ F93), A174 (≠ V220), A203 (= A252), W206 (≠ G255), G226 (= G274), G306 (= G356), R308 (= R358), S333 (≠ G383), R334 (≠ H384), I335 (≠ L385), G336 (= G386), V337 (≠ W387), Q338 (≠ T388)
Sites not aligning to the query:
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
26% identity, 69% coverage: 126:404/406 of query aligns to 85:349/369 of S5FMM4
- S202 (≠ A252) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ W387) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ V397) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 99% coverage: 4:403/406 of query aligns to 4:346/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I7), G8 (= G8), G10 (= G10), V11 (≠ I11), I12 (≠ T12), V30 (≠ Y30), E31 (= E31), K32 (= K32), E38 (= E39), A39 (≠ T40), S40 (= S41), A43 (≠ N44), G45 (= G46), L46 (≠ Q47), V171 (= V220), G200 (≠ A252), G201 (= G253), W203 (≠ G255), G298 (= G356), R300 (= R358), P301 (= P359), Y326 (≠ G383), R327 (≠ H384), N328 (≠ L385), G329 (= G386), I330 (≠ W387)
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
25% identity, 58% coverage: 167:401/406 of query aligns to 121:346/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (≠ T219), V174 (= V220), S202 (≠ A252), G203 (= G253), W205 (≠ G255), F209 (≠ L259), G300 (= G356), R302 (= R358), H327 (= H382), F328 (≠ G383), R329 (≠ H384), N330 (≠ L385), G331 (= G386), I332 (≠ W387)
- binding glycolic acid: Y246 (≠ K301), R302 (= R358), R329 (≠ H384)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
24% identity, 58% coverage: 167:401/406 of query aligns to 121:346/369 of O31616
- V174 (= V220) binding
- H244 (≠ A299) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R358) binding
- 327:333 (vs. 382:388, 29% identical) binding
- R329 (≠ H384) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
24% identity, 58% coverage: 167:401/406 of query aligns to 121:346/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ K301), R302 (= R358), R329 (≠ H384)
- binding flavin-adenine dinucleotide: V174 (= V220), S202 (≠ A252), G203 (= G253), W205 (≠ G255), F209 (≠ L259), G300 (= G356), R302 (= R358), H327 (= H382), R329 (≠ H384), N330 (≠ L385), G331 (= G386), I332 (≠ W387)
- binding phosphate ion: R254 (= R311)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
49% identity, 11% coverage: 2:46/406 of query aligns to 4:48/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G8), G12 (= G10), I14 (≠ T12), E33 (= E31), K34 (= K32), E41 (= E39), T42 (= T40), S43 (= S41), A45 (= A43), N46 (= N44), S47 (≠ G45)
- binding sn-glycerol-3-phosphate: S47 (≠ G45)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 49, 51, 176, 177, 209, 210, 212, 234, 319, 320, 346, 347, 348, 349, 350, 351, 352
- binding sn-glycerol-3-phosphate: 51, 258, 259, 320, 348
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
49% identity, 11% coverage: 2:46/406 of query aligns to 4:48/384 of P75063
Sites not aligning to the query:
- 47:49 binding
- 177 binding
- 346:347 binding
- 352 binding
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
24% identity, 72% coverage: 110:401/406 of query aligns to 64:351/370 of 4yshA
- active site: I262 (≠ V314), L283 (= L335), G305 (= G356), N335 (≠ L385), L338 (≠ T388)
- binding flavin-adenine dinucleotide: V178 (= V220), S206 (≠ A252), G207 (= G253), W209 (≠ G255), R307 (= R358), H332 (= H382), R334 (≠ H384), N335 (≠ L385), G336 (= G386), I337 (≠ W387)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
24% identity, 72% coverage: 110:401/406 of query aligns to 64:351/368 of 4yshB
- active site: I262 (≠ V314), L283 (= L335), G305 (= G356), N335 (≠ L385), L338 (≠ T388)
- binding flavin-adenine dinucleotide: V178 (= V220), S206 (≠ A252), W209 (≠ G255), R307 (= R358), H332 (= H382), R334 (≠ H384), N335 (≠ L385), G336 (= G386), I337 (≠ W387), L338 (≠ T388)
- binding glycine: G249 (≠ A299), Y251 (≠ K301), Y251 (≠ K301), A264 (≠ G316), R307 (= R358), R334 (≠ H384), R334 (≠ H384)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
24% identity, 72% coverage: 110:401/406 of query aligns to 65:353/377 of Q5L2C2
- V180 (= V220) binding
- R309 (= R358) binding
- 334:340 (vs. 382:388, 29% identical) binding
- R336 (≠ H384) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
Query Sequence
>GFF1637 FitnessBrowser__Marino:GFF1637
MKRIAVIGGGITGITTAYTLAKRGLDVTVYEKHRYAAMETSFANGGQLSASNAEVWNNWQ
TVMKGIKWMSRRDAPLLVNPKPSWHKLSWFAEFIAAIPQYEKNTTETARLAIAARDHLFA
WAQEEGIDFDLKKQGILHIYRDKAGFDHAEKVSRLLAAGGLERRSVTPEEMKSIEPTLAG
NYYGGFFTESDSTGDIHKFTNGLADAIKRLGVKTCYGHTVTELSADERNAWVTAHDGTEQ
SRDTFDGVVICAGVGSRGLAKKLGDRVNIYPVKGYSITVELDDEASQKAAPTVSLLDDAT
KIVTSRLGDGRFRVAGTAEFSGYNRDIKDDRIRPLTRWVEQCFPGVCTRKVVPWAGLRPM
LPNMMPRVGPGRLPTVFYNTGHGHLGWTLSAITAELVAESVTGDSR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory