Comparing GFF1639 FitnessBrowser__Marino:GFF1639 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 96% coverage: 12:520/532 of query aligns to 69:618/629 of Q9SS48
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
34% identity, 71% coverage: 2:381/532 of query aligns to 6:394/557 of 2rgoA
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
28% identity, 90% coverage: 34:513/532 of query aligns to 36:477/496 of 3da1A
Sites not aligning to the query:
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
34% identity, 65% coverage: 38:381/532 of query aligns to 38:386/530 of 2rgoB
Sites not aligning to the query:
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
31% identity, 83% coverage: 40:480/532 of query aligns to 27:477/495 of 2r46A
Sites not aligning to the query:
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
31% identity, 83% coverage: 40:480/532 of query aligns to 27:477/495 of 2r45A
Sites not aligning to the query:
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
32% identity, 83% coverage: 40:480/532 of query aligns to 27:477/501 of 2qcuB
Sites not aligning to the query:
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
36% identity, 10% coverage: 15:68/532 of query aligns to 1:55/366 of 3dmeA
Sites not aligning to the query:
>GFF1639 FitnessBrowser__Marino:GFF1639
MTRSEILNALRSGTNEFDVVVVGGGITGAGVAREAAGSGLRTLLVEQKDFSWGTSSRSSK
MVHGGLRYLGSGHYGLTRDAVRERERLMAEAPGLIEPLRFIMPHFKGQFPGPRLFQTLLR
VYDLIARNQSRHFLTPAESMLWVPGLTSENLAGASGFTDAVTDDSRLVLRLIAEARRDGA
MCLNYTRADEIKRSNGDVSGLLIQAEENDTPIEVFAPLVINATGAWADRLQSSKTSEDAM
HIRPLRGSHLVLPWSSLPVSCSVSLFHPEDGRPVFAFPWLGTTVLGTTDIDHEGSLDQEP
VISESETAYLLEIASRLFPGSPITRNDILSTWAGVRPVVTDGTGKSPSKENREHALRVDR
GLVSIAGGKLTTFRVIAREALVQGLGEGSSEVLRPASKPVFQRTDHPSRPATISYQCWQR
LQGFYGPELDQMLASGPLEPVTPNRATDLLWAELCWACRREDVQHLDDLLLRRTRLGMVL
PNAGEALLPEIRNHCQPLLGWADQRWEEEQARYLSTYHNAYSLPPQEASDAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory