Comparing GFF1647 PGA1_c16700 binding protein-dependent transport system, inner membrane component to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
32% identity, 85% coverage: 37:305/316 of query aligns to 14:271/285 of 7cagA
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
32% identity, 85% coverage: 38:305/316 of query aligns to 197:489/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
31% identity, 85% coverage: 38:307/316 of query aligns to 208:506/514 of P02916
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
29% identity, 85% coverage: 23:292/316 of query aligns to 22:288/313 of P94529
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
34% identity, 24% coverage: 172:247/316 of query aligns to 157:224/296 of P68183
>GFF1647 PGA1_c16700 binding protein-dependent transport system, inner membrane component
MAGKAVIARTKTTVVSGGTGARRSLYWQYMVEPFLYLSPMILLIGSVMLIPLIVGISYSF
QSIELLNPFATGWVGFENYEKLWSDRKFWIALENTFFWTFWSIFFQFFLGLGLAMLLNTQ
FFGKKLFQALVFLPWAVPTFLSALTWAWLFNPVIGPIPHWLAALGVLSEPYNILGDPDLA
IWGPITANIWFGVPFFAITLLAALQSIPGELYEAAEIDGATPWQSFTKITLPFLAPMIAI
TVMLRTIWIANFADLIFVMTGGGPANSTQILSTYIFTTAFRKLDFGYASTIAVALLIILL
AYAVILLWMRKRLVKI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory