Comparing GFF1677 FitnessBrowser__Marino:GFF1677 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2qfxA Crystal structure of saccharomyces cerevesiae mitochondrial NADP(+)- dependent isocitrate dehydrogenase in complex with NADPH, a- ketoglutarate and ca(2+) (see paper)
29% identity, 46% coverage: 4:266/572 of query aligns to 9:262/410 of 2qfxA
Sites not aligning to the query:
2qfvA Crystal structure of saccharomyces cerevesiae mitochondrial NADP(+)- dependent isocitrate dehydrogenase in complex with NADP(+) (see paper)
29% identity, 46% coverage: 4:266/572 of query aligns to 9:262/410 of 2qfvA
Sites not aligning to the query:
2qfyA Crystal structure of saccharomyces cerevesiae mitochondrial NADP(+)- dependent isocitrate dehydrogenase in complex with a-ketoglutarate (see paper)
29% identity, 46% coverage: 4:266/572 of query aligns to 9:262/411 of 2qfyA
4aouA Ctidh bound to NADP. The complex structures of isocitrate dehydrogenase from clostridium thermocellum and desulfotalea psychrophila, support a new active site locking mechanism (see paper)
30% identity, 46% coverage: 1:264/572 of query aligns to 5:256/401 of 4aouA
Sites not aligning to the query:
4aovA Dpidh-NADP. The complex structures of isocitrate dehydrogenase from clostridium thermocellum and desulfotalea psychrophila, support a new active site locking mechanism (see paper)
28% identity, 47% coverage: 1:266/572 of query aligns to 5:258/401 of 4aovA
Sites not aligning to the query:
2uxqA Isocitrate dehydrogenase from the psychrophilic bacterium desulfotalea psychrophila: biochemical properties and crystal structure analysis (see paper)
28% identity, 47% coverage: 1:266/572 of query aligns to 5:258/402 of 2uxqA
Sites not aligning to the query:
4hcxA Structure of icdh-1 from m.Tuberculosis complexed with NADPH & mn2+ (see paper)
32% identity, 46% coverage: 1:264/572 of query aligns to 5:258/402 of 4hcxA
Sites not aligning to the query:
P33198 Isocitrate dehydrogenase [NADP], mitochondrial; IDH; ICD-M; IDP; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase; EC 1.1.1.42 from Sus scrofa (Pig) (see 2 papers)
28% identity, 47% coverage: 1:266/572 of query aligns to 15:269/421 of P33198
Sites not aligning to the query:
P48735 Isocitrate dehydrogenase [NADP], mitochondrial; IDH; ICD-M; IDP; NADP(+)-specific ICDH; Oxalosuccinate decarboxylase; EC 1.1.1.42 from Homo sapiens (Human) (see 4 papers)
28% identity, 47% coverage: 1:266/572 of query aligns to 46:300/452 of P48735
Sites not aligning to the query:
5h3eB Crystal structure of mouse isocitrate dehydrogenases 2 k256q mutant complexed with isocitrate (see paper)
29% identity, 46% coverage: 4:266/572 of query aligns to 8:259/410 of 5h3eB
Sites not aligning to the query:
6ajcA Crystal structure of trypanosoma cruzi cytosolic isocitrate dehydrogenase in complex with NADP+, isocitrate and ca2+
29% identity, 45% coverage: 5:261/572 of query aligns to 10:255/413 of 6ajcA
Sites not aligning to the query:
5svoA Structure of idh2 mutant r140q (see paper)
28% identity, 47% coverage: 1:266/572 of query aligns to 5:259/410 of 5svoA
Sites not aligning to the query:
6adiA Crystal structures of idh2 r140q in complex with ag-881 (see paper)
28% identity, 47% coverage: 1:266/572 of query aligns to 6:260/418 of 6adiA
Sites not aligning to the query:
5i95A Crystal structure of human mitochondrial isocitrate dehydrogenase r140q mutant homodimer bound to NADPH and alpha-ketoglutaric acid (see paper)
28% identity, 47% coverage: 1:266/572 of query aligns to 6:260/413 of 5i95A
Sites not aligning to the query:
4ja8A Complex of mitochondrial isocitrate dehydrogenase r140q mutant with agi-6780 inhibitor (see paper)
28% identity, 47% coverage: 1:266/572 of query aligns to 6:260/416 of 4ja8A
Sites not aligning to the query:
5i96A Crystal structure of human mitochondrial isocitrate dehydrogenase (idh2) r140q mutant homodimer in complex with ag-221 (enasidenib) inhibitor. (see paper)
28% identity, 47% coverage: 1:266/572 of query aligns to 6:260/417 of 5i96A
Sites not aligning to the query:
5l57A Crystal structure of iso-citrate dehydrogenase r132h in complex with a novel inhibitor (compound 13a) (see paper)
29% identity, 45% coverage: 5:262/572 of query aligns to 8:252/409 of 5l57A
Sites not aligning to the query:
5lgeA Crystal structure of human idh1 mutant (r132h) in complex with NADP+ and an inhibitor related to bay 1436032 (see paper)
29% identity, 45% coverage: 5:262/572 of query aligns to 8:247/406 of 5lgeA
Sites not aligning to the query:
8bayA Crystal structure of idh1 variant r132c s280f in complex with NADPH, ca2+ and 3-butyl-2-oxoglutarate (see paper)
29% identity, 45% coverage: 5:262/572 of query aligns to 8:255/414 of 8bayA
Sites not aligning to the query:
1t0lA Crystal structure of human cytosolic NADP(+)-dependent isocitrate dehydrogenase in complex with NADP, isocitrate, and calcium(2+) (see paper)
29% identity, 45% coverage: 5:262/572 of query aligns to 10:257/414 of 1t0lA
Sites not aligning to the query:
>GFF1677 FitnessBrowser__Marino:GFF1677
MTSPLVILHGDEMAQVAFEHILKKFVNSRLDIQLEEIDLSAENRLLTNGQVVIDAIDSLQ
RHGVGVKNAGMTVNRQQLEDLLRKHPGVDGENLHPLATKSPNGAIRKGISGNITREDIQF
RNLNIRRPQWVGRDIEVDTMEFGGIKDSFNQLSLATGVVKLMFVGSSGDPVELHRREIRK
GDPWLLATNDIEDVKAWAHRFFQRAIAEKRDVYLGLKDTVIPGYDGAMRSVIEDIYHSDY
KKQIEDLGLNYYYELIDAQAARIVSNPPERALWGVPDNTTGRKLLKLVNQLKEFGIPGRG
AHVSISRMSAGGGDQYGSFNMAAKEDGILKVIVDGDEKHARRVRKGDPMLLMSNDREAIK
DWVLQVFRDASRKDKEVYFGLKREYMEYDEVYSEVITEVRRELASEHTPPPSFMIMRPSS
QLKKMITDPPRNALYPSQNLDGDIFSDISAALGGSLATASSIIESKDGTMLFEAPHGTAH
DLYLKYLESDGKVAHFNPSALIFALGNALETLGEREGNEPLSQYAVQLKAALTDTVDRGI
VTADLKGKTVDPDSEQVVDMIGFLEAVEKALQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory