SitesBLAST
Comparing GFF1678 FitnessBrowser__psRCH2:GFF1678 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
84% identity, 98% coverage: 5:253/253 of query aligns to 3:251/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G16 (= G18), I17 (= I19), D36 (= D38), L37 (≠ I39), C61 (= C63), D62 (= D64), V63 (= V65), N89 (= N91), A90 (= A92), T140 (= T142), S142 (= S144), Y155 (= Y157), K159 (= K161), A186 (= A188), V187 (= V189)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
43% identity, 98% coverage: 5:253/253 of query aligns to 3:248/248 of 6ixmC
- active site: G16 (= G18), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (≠ A17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (= I39), A61 (≠ C63), D62 (= D64), T63 (≠ V65), N89 (= N91), A90 (= A92), M140 (≠ T142), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (= A188), Y187 (≠ V189), I188 (= I190), L192 (≠ M194)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
41% identity, 100% coverage: 1:252/253 of query aligns to 1:254/255 of 5itvA
- active site: G18 (= G18), S141 (= S144), Y154 (= Y157), K158 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (≠ A17), G18 (= G18), I19 (= I19), D38 (= D38), I39 (= I39), T61 (≠ C63), I63 (≠ V65), N89 (= N91), G91 (= G93), T139 (= T142), S141 (= S144), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (≠ A188), I186 (≠ V189), I187 (= I190)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
41% identity, 99% coverage: 3:252/253 of query aligns to 1:247/248 of 4urfB
- active site: G16 (= G18), S142 (= S144), I152 (≠ M154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ V215), R211 (≠ G216), R212 (= R217)
- binding bicarbonate ion: I92 (= I94), G94 (≠ I96), R109 (≠ A111), R179 (= R181), S228 (≠ C233)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G14 (≠ A16), N15 (≠ A17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (= I39), D62 (= D64), T63 (≠ V65), N89 (= N91), A90 (= A92), G91 (= G93), I140 (≠ T142), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (= A188), I188 (= I190), T190 (= T192)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
41% identity, 99% coverage: 3:252/253 of query aligns to 1:247/248 of 4urfA
- active site: G16 (= G18), S142 (= S144), I152 (≠ M154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I94), S93 (≠ E95), G94 (≠ I96), E95 (= E97), T97 (≠ G99), E101 (= E103), T103 (≠ S105), Q106 (≠ E108), R109 (≠ A111), S175 (≠ K177), G177 (≠ K179)
- binding magnesium ion: S237 (≠ Q242), Y238 (≠ A243)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G14 (≠ A16), N15 (≠ A17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (= I39), W41 (≠ G43), D62 (= D64), T63 (≠ V65), N89 (= N91), A90 (= A92), G91 (= G93), I140 (≠ T142), Y155 (= Y157), K159 (= K161), P185 (= P187), I188 (= I190), T190 (= T192)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
41% identity, 99% coverage: 3:252/253 of query aligns to 1:247/248 of 4ureB
- active site: G16 (= G18), S142 (= S144), I152 (≠ M154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ A17), G16 (= G18), I17 (= I19), N89 (= N91), G91 (= G93), Y155 (= Y157), P185 (= P187), A186 (= A188)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
38% identity, 98% coverage: 5:252/253 of query aligns to 11:265/267 of Q9LBG2
- 17:42 (vs. 11:36, 50% identical) binding
- E103 (= E95) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
1iy8A Crystal structure of levodione reductase (see paper)
38% identity, 98% coverage: 5:252/253 of query aligns to 2:256/258 of 1iy8A
- active site: G15 (= G18), S143 (= S144), Q153 (≠ M154), Y156 (= Y157), K160 (= K161)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), S14 (≠ A17), G15 (= G18), L16 (≠ I19), D35 (= D38), V36 (≠ I39), A62 (≠ C63), D63 (= D64), V64 (= V65), N90 (= N91), G92 (= G93), I93 (= I94), T141 (= T142), S143 (= S144), Y156 (= Y157), K160 (= K161), P186 (= P187), G187 (≠ A188), T191 (= T192), P192 (≠ D193), M193 (= M194)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
41% identity, 100% coverage: 1:252/253 of query aligns to 1:226/227 of 5itvD
- active site: G18 (= G18), S141 (= S144), Y154 (= Y157), K158 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (≠ A17), G18 (= G18), I19 (= I19), D38 (= D38), I39 (= I39), T61 (≠ C63), D62 (= D64), I63 (≠ V65), N89 (= N91), T139 (= T142), S141 (= S144), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (≠ A188), I187 (= I190)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
38% identity, 100% coverage: 1:252/253 of query aligns to 1:260/261 of 6zzsD
- active site: G18 (= G18), S143 (= S144), Y156 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), S17 (≠ A17), I19 (= I19), D38 (= D38), M39 (≠ I39), D64 (= D64), V65 (= V65), N91 (= N91), A92 (= A92), G93 (= G93), M141 (≠ T142), A142 (= A143), S143 (= S144), Y156 (= Y157), K160 (= K161), P186 (= P187), G187 (≠ A188), V189 (≠ I190), T191 (= T192), L193 (≠ M194)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ E95), S143 (= S144), N145 (≠ A146), K153 (≠ M154), Y156 (= Y157), Q197 (vs. gap)
5h5xC Crystal structure of nadh bound carbonyl reductase from streptomyces coelicolor
42% identity, 98% coverage: 5:253/253 of query aligns to 11:257/257 of 5h5xC
- active site: G24 (= G18), S151 (= S144), Y164 (= Y157), K168 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G14), S23 (≠ A17), G24 (= G18), I25 (= I19), D44 (= D38), F45 (≠ I39), L69 (≠ C63), D70 (= D64), N97 (= N91), A98 (= A92), Y164 (= Y157), K168 (= K161), P194 (= P187), G195 (≠ A188), I197 (= I190), T199 (= T192)
2dtxA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose (see paper)
40% identity, 96% coverage: 8:251/253 of query aligns to 8:246/255 of 2dtxA
2dteA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with nadh (see paper)
40% identity, 96% coverage: 8:251/253 of query aligns to 8:246/255 of 2dteA
- active site: G18 (= G18), S132 (= S144), Y145 (= Y157), S148 (= S160), K149 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S16 (≠ A16), M17 (≠ A17), G18 (= G18), I19 (= I19), S38 (≠ G43), I39 (= I44), C52 (= C63), D53 (= D64), V54 (= V65), N80 (= N91), A81 (= A92), I130 (≠ T142), S132 (= S144), Y145 (= Y157), K149 (= K161), P174 (= P187), A175 (= A188), T176 (≠ V189), I177 (= I190), T179 (= T192), P180 (≠ D193), L181 (≠ M194), V182 (≠ F195)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
42% identity, 98% coverage: 1:249/253 of query aligns to 1:243/246 of 3osuA
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
36% identity, 100% coverage: 1:252/253 of query aligns to 4:252/258 of 4wecA
- active site: G21 (= G18), S143 (= S144), Q154 (≠ M154), Y157 (= Y157), K161 (= K161)
- binding nicotinamide-adenine-dinucleotide: G17 (= G14), A19 (= A16), S20 (≠ A17), G21 (= G18), I22 (= I19), D41 (= D38), I42 (= I39), V61 (≠ C63), D62 (= D64), V63 (= V65), N89 (= N91), T141 (= T142), Y157 (= Y157), K161 (= K161), P187 (= P187), P189 (≠ V189), V190 (≠ I190)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
41% identity, 95% coverage: 10:249/253 of query aligns to 4:236/239 of 3sj7A
- active site: G12 (= G18), S138 (= S144), Q148 (≠ M154), Y151 (= Y157), K155 (= K161)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (≠ A16), R11 (≠ A17), I13 (= I19), N31 (≠ D40), Y32 (≠ E41), A33 (= A42), G34 (= G43), S35 (≠ I44), A58 (≠ C63), N59 (≠ D64), V60 (= V65), N86 (= N91), A87 (= A92), T109 (≠ V115), S138 (= S144), Y151 (= Y157), K155 (= K161), P181 (= P187), G182 (≠ A188)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
38% identity, 98% coverage: 5:252/253 of query aligns to 4:259/260 of 6zzqA
- active site: G17 (= G18), S142 (= S144), Y155 (= Y157)
- binding acetoacetic acid: Q94 (≠ E95), S142 (= S144), K152 (≠ M154), Y155 (= Y157), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G13 (= G14), S16 (≠ A17), G17 (= G18), I18 (= I19), D37 (= D38), M38 (≠ I39), D63 (= D64), V64 (= V65), N90 (= N91), A91 (= A92), G92 (= G93), M140 (≠ T142), A141 (= A143), S142 (= S144), Y155 (= Y157), K159 (= K161), Y187 (≠ V189), V188 (≠ I190), T190 (= T192)
4qecA Elxo with NADP bound (see paper)
34% identity, 94% coverage: 11:249/253 of query aligns to 6:244/248 of 4qecA
- active site: G13 (= G18), N111 (= N116), S139 (= S144), Y152 (= Y157), K156 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ A17), G13 (= G18), I14 (= I19), S33 (≠ A37), R34 (≠ D38), K38 (≠ A42), D59 (= D64), V60 (= V65), N86 (= N91), A87 (= A92), G88 (= G93), I137 (≠ T142), Y152 (= Y157), K156 (= K161), P182 (= P187), I185 (= I190)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
38% identity, 98% coverage: 3:249/253 of query aligns to 1:242/248 of Q9KJF1
- M1 (= M3) modified: Initiator methionine, Removed
- S15 (≠ A17) binding
- D36 (= D38) binding
- D62 (= D64) binding
- I63 (≠ V65) binding
- N89 (= N91) binding
- Y153 (= Y157) binding
- K157 (= K161) binding
4nbuB Crystal structure of fabg from bacillus sp (see paper)
40% identity, 96% coverage: 8:249/253 of query aligns to 8:241/244 of 4nbuB
- active site: G18 (= G18), N111 (= N116), S139 (= S144), Q149 (≠ M154), Y152 (= Y157), K156 (= K161)
- binding acetoacetyl-coenzyme a: D93 (≠ Q98), K98 (≠ E103), S139 (= S144), N146 (≠ A151), V147 (≠ P152), Q149 (≠ M154), Y152 (= Y157), F184 (≠ V189), M189 (= M194), K200 (≠ F208)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ A17), G18 (= G18), I19 (= I19), D38 (= D38), F39 (≠ I39), V59 (≠ C63), D60 (= D64), V61 (= V65), N87 (= N91), A88 (= A92), G89 (= G93), I90 (= I94), T137 (= T142), S139 (= S144), Y152 (= Y157), K156 (= K161), P182 (= P187), F184 (≠ V189), T185 (≠ I190), T187 (= T192), M189 (= M194)
Query Sequence
>GFF1678 FitnessBrowser__psRCH2:GFF1678
MSMTFSGQVALVTGAAAGIGRATAQAFAEQGLKVVLADIDEAGIRDGAESIRAAGGEAIA
VRCDVTRDAEVKALIEQVLAQFGRLDYAFNNAGIEIEQGRLAEGSEAEFDAIMGVNVKGV
WLCMKHQLPVMLAQGGGAIVNTASVAGLGAAPKMSIYAASKHAVIGLTKSAAIEYAKKKI
RVNAVCPAVIDTDMFRRAYEADPRKAEFAAAMHPVGRIGKVEEIAAAVLYLCCDGAAFTT
GQALAVDGGATAI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory