SitesBLAST
Comparing GFF1690 FitnessBrowser__Marino:GFF1690 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
32% identity, 69% coverage: 144:463/466 of query aligns to 70:396/404 of 3wx9A
- binding 2-oxoglutaric acid: D213 (= D283), P214 (≠ I284), Y215 (= Y285), G216 (≠ A286), E217 (= E287), G241 (≠ S310), T242 (≠ S311), I246 (≠ V315)
- binding (2E)-pent-2-enedioic acid: Y130 (≠ F204), N184 (≠ T254), R376 (= R443)
- binding glutamic acid: L131 (≠ Y205), V360 (≠ T427), A364 (≠ L431), R369 (≠ G436)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G178), S105 (≠ C179), Q106 (= Q180), Y130 (≠ F204), N184 (≠ T254), D212 (= D282), P214 (≠ I284), Y215 (= Y285), T242 (≠ S311), S244 (= S313), K245 (= K314), R252 (= R321)
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
32% identity, 69% coverage: 144:463/466 of query aligns to 70:396/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: L131 (≠ Y205), Q135 (= Q209), A364 (≠ L431), R369 (≠ G436)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: Y130 (≠ F204), L131 (≠ Y205), A132 (≠ G206), N184 (≠ T254), R376 (= R443)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G178), S105 (≠ C179), Q106 (= Q180), Y130 (≠ F204), V179 (≠ S249), N184 (≠ T254), D212 (= D282), P214 (≠ I284), Y215 (= Y285), T242 (≠ S311), S244 (= S313), K245 (= K314), R252 (= R321)
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
32% identity, 69% coverage: 144:463/466 of query aligns to 70:396/404 of 3aowC
- binding 2-oxoglutaric acid: Y70 (= Y144), Y130 (≠ F204), L275 (= L343)
- binding pyridoxal-5'-phosphate: G104 (= G178), S105 (≠ C179), Q106 (= Q180), Y130 (≠ F204), V179 (≠ S249), N184 (≠ T254), D212 (= D282), P214 (≠ I284), Y215 (= Y285), T242 (≠ S311), S244 (= S313), K245 (= K314), R252 (= R321)
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
32% identity, 69% coverage: 144:463/466 of query aligns to 70:396/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G178), S105 (≠ C179), Q106 (= Q180), Y130 (≠ F204), V179 (≠ S249), N184 (≠ T254), D212 (= D282), P214 (≠ I284), Y215 (= Y285), T242 (≠ S311), S244 (= S313), K245 (= K314), R252 (= R321)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
31% identity, 62% coverage: 159:447/466 of query aligns to 79:372/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: G99 (= G178), S100 (≠ C179), Q101 (= Q180), Y125 (≠ F204), N174 (≠ T254), D202 (= D282), Y205 (= Y285), S235 (= S311), S237 (= S313), K238 (= K314), R245 (= R321), R368 (= R443)
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
31% identity, 62% coverage: 159:447/466 of query aligns to 79:372/397 of Q72LL6
- N174 (≠ T254) binding ; binding
- R245 (= R321) binding
- R368 (= R443) binding
Sites not aligning to the query:
- 20 S→E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- 23 R→A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; R→Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
- 40 binding
- 70 binding
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
31% identity, 62% coverage: 159:447/466 of query aligns to 75:368/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: G95 (= G178), S96 (≠ C179), Q97 (= Q180), Y121 (≠ F204), N170 (≠ T254), D198 (= D282), Y201 (= Y285), S231 (= S311), S233 (= S313), K234 (= K314), R241 (= R321), R364 (= R443)
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
31% identity, 62% coverage: 159:447/466 of query aligns to 75:368/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G178), S96 (≠ C179), Q97 (= Q180), Y121 (≠ F204), N170 (≠ T254), D198 (= D282), A200 (≠ I284), Y201 (= Y285), S231 (= S311), S233 (= S313), K234 (= K314), R241 (= R321)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
31% identity, 62% coverage: 159:447/466 of query aligns to 71:364/389 of 2z1yA
- binding leucine: Y117 (≠ F204), R360 (= R443)
- binding pyridoxal-5'-phosphate: G91 (= G178), S92 (≠ C179), Q93 (= Q180), Y117 (≠ F204), N166 (≠ T254), D194 (= D282), Y197 (= Y285), S227 (= S311), S229 (= S313), K230 (= K314), R237 (= R321)
Sites not aligning to the query:
6t8qA Hkatii in complex with ligand (2r)-n-benzyl-1-[6-methyl-5-(oxan-4-yl)- 7-oxo-6h,7h-[1,3]thiazolo[5,4-d]pyrimidin-2-yl]pyrrolidine-2- carboxamide (see paper)
32% identity, 59% coverage: 172:447/466 of query aligns to 113:406/428 of 6t8qA
2xh1A Crystal structure of human kat ii-inhibitor complex (see paper)
32% identity, 59% coverage: 172:447/466 of query aligns to 97:390/412 of 2xh1A
- binding (3s)-10-(4-aminopiperazin-1-yl)-9-fluoro-7-hydroxy-3-methyl-2,3-dihydro-8h-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylate: L280 (vs. gap)
- binding pyridoxal-5'-phosphate: S104 (≠ C179), Q105 (= Q180), Y129 (≠ F204), D217 (= D282), P219 (≠ I284), S247 (= S311), S249 (= S313), R257 (= R321)
Sites not aligning to the query:
2vgzA Crystal structure of human kynurenine aminotransferase ii (see paper)
32% identity, 59% coverage: 172:447/466 of query aligns to 99:392/414 of 2vgzA
5tf5A Crystal structure of human kat-2 in complex with a reversible inhibitor
32% identity, 59% coverage: 172:447/466 of query aligns to 110:403/425 of 5tf5A
Sites not aligning to the query:
2r2nA The crystal structure of human kynurenine aminotransferase ii in complex with kynurenine (see paper)
32% identity, 59% coverage: 172:447/466 of query aligns to 110:403/425 of 2r2nA
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: Y142 (≠ F204), R399 (= R443)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S117 (≠ C179), Q118 (= Q180), Y142 (≠ F204), N202 (≠ T254), D230 (= D282), P232 (≠ I284), Y233 (= Y285), S260 (= S311), S262 (= S313), K263 (= K314), R270 (= R321)
Sites not aligning to the query:
3ue8A Kynurenine aminotransferase ii inhibitors (see paper)
32% identity, 59% coverage: 172:447/466 of query aligns to 93:386/410 of 3ue8A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: S100 (≠ C179), Q101 (= Q180), Y125 (≠ F204), N185 (≠ T254), D213 (= D282), P215 (≠ I284), Y216 (= Y285), S243 (= S311), S245 (= S313), K246 (= K314), R253 (= R321), R382 (= R443)
Sites not aligning to the query:
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
32% identity, 59% coverage: 172:447/466 of query aligns to 110:403/428 of 4gebA
- binding (5-hydroxy-4-{[(7-hydroxy-6-oxo-2-phenyl-6,7-dihydro-2H-pyrazolo[3,4-b]pyridin-5-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: S117 (≠ C179), Q118 (= Q180), Y142 (≠ F204), N202 (≠ T254), D230 (= D282), P232 (≠ I284), Y233 (= Y285), S260 (= S311), S262 (= S313), K263 (= K314), R270 (= R321), R399 (= R443)
Sites not aligning to the query:
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
32% identity, 59% coverage: 172:447/466 of query aligns to 110:403/428 of 4ge9A
- binding (4-{[(6-benzyl-1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: S117 (≠ C179), Q118 (= Q180), Y142 (≠ F204), N202 (≠ T254), D230 (= D282), P232 (≠ I284), Y233 (= Y285), S260 (= S311), S262 (= S313), R270 (= R321), L293 (vs. gap), R399 (= R443)
Sites not aligning to the query:
4ge7A Kynurenine aminotransferase ii inhibitors (see paper)
32% identity, 59% coverage: 172:447/466 of query aligns to 110:403/428 of 4ge7A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-6-phenoxy-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: S117 (≠ C179), Q118 (= Q180), Y142 (≠ F204), N202 (≠ T254), D230 (= D282), P232 (≠ I284), Y233 (= Y285), S260 (= S311), S262 (= S313), R270 (= R321), L293 (vs. gap), R399 (= R443)
Sites not aligning to the query:
4gdyB Kynurenine aminotransferase ii inhibitors
32% identity, 59% coverage: 172:447/466 of query aligns to 110:403/428 of 4gdyB
- binding (5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: G116 (= G178), S117 (≠ C179), Q118 (= Q180), Y142 (≠ F204), N202 (≠ T254), D230 (= D282), P232 (≠ I284), S260 (= S311), S262 (= S313), R270 (= R321), R399 (= R443)
Sites not aligning to the query:
4ge4A Kynurenine aminotransferase ii inhibitors (see paper)
32% identity, 59% coverage: 172:447/466 of query aligns to 104:397/422 of 4ge4A
- binding (5-hydroxy-4-{[(1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G110 (= G178), S111 (≠ C179), Q112 (= Q180), Y136 (≠ F204), N196 (≠ T254), D224 (= D282), P226 (≠ I284), Y227 (= Y285), S254 (= S311), S256 (= S313), K257 (= K314), R264 (= R321), R393 (= R443)
Sites not aligning to the query:
Query Sequence
>GFF1690 FitnessBrowser__Marino:GFF1690
MAKPLPRYQKLEVTLRDQIETGRWRGGERLPSIRSLCQDYHLSKITVQHALQRLEALGLI
EARERSGFFVVPPQNKFEVPGQAPTPDEPKPVSVSQVFQDIMTRSAAFDLLPACNRDEPP
PGIIQLNRSIGRALRRQSTRFQYYDEPAGDQELRNQIALRAARRGWIAQADDFCITSGCQ
QSLFLALMAVCKSGDVVAVETPGFYGVLQLLEQLQLRVIEIPASPESGMNVSALEDVLKV
WDVKACVVSPAFATPTGSVMPTEARRGLLALADRHDVAIIEDDIYAESGWLNVPDTLKAI
DTSARVIHCSSFSKVLSRDLRLGWVSGGRWHDEILKLKLTSQLASSRFLQEGVAGFIAEG
GYASFLRRHRQDLRRRRDQLLELLSGWNVSLRVTTPHGGLALWVELQEDVDTLRLYGRAL
QEGIVITPGNLFSVSGKFSNCLRISFAHPWNAARVSALKRLPELMI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory