SitesBLAST
Comparing GFF1711 FitnessBrowser__Phaeo:GFF1711 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hdtA Crystal structure of a carnitinyl-coa dehydratase from mycobacterium thermoresistibile (see paper)
40% identity, 99% coverage: 3:346/348 of query aligns to 3:340/340 of 4hdtA
- active site: G64 (= G64), I69 (≠ L69), W84 (= W85), Y88 (= Y89), G112 (= G113), G115 (= G116), E135 (= E136), P142 (= P143), D143 (= D144), R283 (≠ E285)
- binding zinc ion: H28 (≠ Y28), E42 (≠ A42), E57 (= E57), E79 (≠ Y80), H93 (≠ R94), H185 (≠ E186), E340 (= E346)
Q9LKJ1 3-hydroxyisobutyryl-CoA hydrolase 1; CoA-thioester hydrolase CHY1; EC 3.1.2.-; EC 3.1.2.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 87% coverage: 15:318/348 of query aligns to 22:337/378 of Q9LKJ1
- G70 (= G64) mutation to S: Loss of activity.
- E142 (= E136) mutation to A: Loss of activity.
- D150 (= D144) mutation to G: Reduced activity.
3bptA Crystal structure of human beta-hydroxyisobutyryl-coa hydrolase in complex with quercetin
34% identity, 97% coverage: 10:345/348 of query aligns to 13:357/362 of 3bptA
- active site: G67 (= G64), P84 (≠ R82), R88 (= R86), G115 (= G113), G118 (= G116), E138 (= E136), D146 (= D144)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: G66 (= G63), G67 (= G64), I69 (= I66), E90 (= E88), G114 (= G112), G115 (= G113), E138 (= E136), D146 (= D144), V147 (= V145)
- binding 3,5,7,3',4'-pentahydroxyflavone: F25 (≠ A22), L26 (= L23), A28 (= A25), G66 (= G63), G67 (= G64), I69 (= I66), P137 (= P135), I141 (= I139), L319 (≠ I308)
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
36% identity, 50% coverage: 13:185/348 of query aligns to 18:182/258 of 1mj3A
- active site: A68 (≠ G64), M73 (≠ L69), S83 (≠ Y80), L85 (≠ R82), G109 (= G113), E112 (≠ G116), P131 (= P135), E132 (= E136), T137 (≠ L141), P139 (= P143), G140 (≠ D144)
- binding hexanoyl-coenzyme a: K26 (= K21), A27 (= A22), L28 (= L23), A30 (= A25), A66 (= A62), G67 (= G63), A68 (≠ G64), D69 (= D65), I70 (= I66), G109 (= G113), P131 (= P135), E132 (= E136), L135 (≠ I139), G140 (≠ D144)
Sites not aligning to the query:
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
35% identity, 50% coverage: 13:185/348 of query aligns to 17:178/254 of 2dubA
- active site: A67 (≠ G64), M72 (≠ L69), S82 (≠ R90), G105 (= G113), E108 (≠ G116), P127 (= P135), E128 (= E136), T133 (≠ L141), P135 (= P143), G136 (≠ D144)
- binding octanoyl-coenzyme a: K25 (= K21), A26 (= A22), L27 (= L23), A29 (= A25), A65 (= A62), A67 (≠ G64), D68 (= D65), I69 (= I66), K70 (≠ A67), G105 (= G113), E108 (≠ G116), P127 (= P135), E128 (= E136), G136 (≠ D144), A137 (≠ V145)
Sites not aligning to the query:
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
36% identity, 50% coverage: 13:185/348 of query aligns to 48:214/290 of P14604
- E144 (≠ G116) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E136) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
36% identity, 50% coverage: 13:185/348 of query aligns to 18:184/260 of 1dubA
- active site: A68 (≠ G64), M73 (≠ L69), S83 (≠ Y80), L87 (≠ F84), G111 (= G113), E114 (≠ G116), P133 (= P135), E134 (= E136), T139 (≠ L141), P141 (= P143), G142 (≠ D144)
- binding acetoacetyl-coenzyme a: K26 (= K21), A27 (= A22), L28 (= L23), A30 (= A25), A66 (= A62), A68 (≠ G64), D69 (= D65), I70 (= I66), Y107 (≠ F109), G110 (= G112), G111 (= G113), E114 (≠ G116), P133 (= P135), E134 (= E136), L137 (≠ I139), G142 (≠ D144)
Sites not aligning to the query:
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
36% identity, 50% coverage: 13:185/348 of query aligns to 18:184/260 of 2hw5C
- active site: A68 (≠ G64), M73 (≠ L69), S83 (≠ G81), L87 (≠ W85), G111 (= G113), E114 (≠ G116), P133 (= P135), E134 (= E136), T139 (≠ L141), P141 (= P143), G142 (≠ D144)
- binding crotonyl coenzyme a: K26 (= K21), A27 (= A22), L28 (= L23), A30 (= A25), K62 (= K58), I70 (= I66), F109 (≠ M111)
Sites not aligning to the query:
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
36% identity, 50% coverage: 13:185/348 of query aligns to 16:182/258 of 1ey3A
- active site: A66 (≠ G64), M71 (≠ L69), S81 (≠ Y80), L85 (≠ F84), G109 (= G113), E112 (≠ G116), P131 (= P135), E132 (= E136), T137 (≠ L141), P139 (= P143), G140 (≠ D144)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (= K21), L26 (= L23), A28 (= A25), A64 (= A62), G65 (= G63), A66 (≠ G64), D67 (= D65), I68 (= I66), L85 (≠ F84), W88 (≠ D87), G109 (= G113), P131 (= P135), L135 (≠ I139), G140 (≠ D144)
Sites not aligning to the query:
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
27% identity, 67% coverage: 4:236/348 of query aligns to 6:225/259 of 5zaiC
- active site: A65 (≠ G64), F70 (≠ L69), S82 (≠ W85), R86 (≠ Y89), G110 (= G113), E113 (≠ G116), P132 (= P135), E133 (= E136), I138 (≠ L141), P140 (= P143), G141 (≠ D144)
- binding coenzyme a: K24 (≠ A22), L25 (= L23), A63 (= A62), G64 (= G63), A65 (≠ G64), D66 (= D65), I67 (= I66), P132 (= P135), R166 (= R168)
Sites not aligning to the query:
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
31% identity, 50% coverage: 11:185/348 of query aligns to 12:180/256 of 3h81A
- active site: A64 (≠ G64), M69 (≠ L69), T79 (≠ W85), F83 (≠ Y89), G107 (= G113), E110 (≠ G116), P129 (= P135), E130 (= E136), V135 (≠ L141), P137 (= P143), G138 (≠ D144)
Sites not aligning to the query:
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
31% identity, 50% coverage: 11:185/348 of query aligns to 13:181/255 of 3q0jC
- active site: A65 (≠ G64), M70 (≠ L69), T80 (≠ W85), F84 (≠ Y89), G108 (= G113), E111 (≠ G116), P130 (= P135), E131 (= E136), V136 (≠ L141), P138 (= P143), G139 (≠ D144)
- binding acetoacetyl-coenzyme a: Q23 (≠ K21), A24 (= A22), L25 (= L23), A27 (= A25), A63 (= A62), G64 (= G63), A65 (≠ G64), D66 (= D65), I67 (= I66), K68 (≠ A67), M70 (≠ L69), F84 (≠ Y89), G107 (= G112), G108 (= G113), E111 (≠ G116), P130 (= P135), E131 (= E136), P138 (= P143), G139 (≠ D144), M140 (≠ V145)
Sites not aligning to the query:
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
31% identity, 50% coverage: 11:185/348 of query aligns to 13:181/255 of 3q0gC
- active site: A65 (≠ G64), M70 (≠ L69), T80 (≠ W85), F84 (≠ Y89), G108 (= G113), E111 (≠ G116), P130 (= P135), E131 (= E136), V136 (≠ L141), P138 (= P143), G139 (≠ D144)
- binding coenzyme a: L25 (= L23), A63 (= A62), I67 (= I66), K68 (≠ A67), Y104 (≠ F109), P130 (= P135), E131 (= E136), L134 (≠ I139)
Sites not aligning to the query:
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
30% identity, 50% coverage: 11:185/348 of query aligns to 12:176/250 of 3q0gD
- active site: A64 (≠ G64), M69 (≠ L69), T75 (≠ S75), F79 (≠ Y89), G103 (= G113), E106 (≠ G116), P125 (= P135), E126 (= E136), V131 (≠ L141), P133 (= P143), G134 (≠ D144)
Sites not aligning to the query:
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
31% identity, 47% coverage: 24:186/348 of query aligns to 27:186/261 of 5jbxB
- active site: A67 (≠ G64), R72 (≠ T72), L84 (≠ R86), R88 (= R90), G112 (= G113), E115 (≠ G116), T134 (≠ P135), E135 (= E136), I140 (≠ L141), P142 (= P143), G143 (≠ D144)
- binding coenzyme a: A28 (= A25), A65 (= A62), D68 (= D65), L69 (= L69), K70 (≠ Y70), L110 (≠ M111), G111 (= G112), T134 (≠ P135), E135 (= E136), L138 (≠ I139), R168 (= R168)
Sites not aligning to the query:
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
29% identity, 47% coverage: 23:187/348 of query aligns to 25:189/707 of 6yswA
- active site: A66 (≠ G64), I71 (≠ L69), A84 (≠ W85), Q88 (≠ Y89), G112 (= G113), E115 (vs. gap), P136 (= P135), E137 (= E136), G145 (≠ D144)
- binding coenzyme a: M25 (≠ L23), A66 (≠ G64), D67 (= D65), I68 (= I66), P136 (= P135), E137 (= E136), L140 (≠ I139)
Sites not aligning to the query:
7borA Structure of pseudomonas aeruginosa coa-bound odaa (see paper)
32% identity, 42% coverage: 6:151/348 of query aligns to 4:143/247 of 7borA
- active site: N63 (≠ G64), F68 (vs. gap), D77 (= D77), G81 (= G81), I105 (≠ G113), T108 (≠ G116), F128 (≠ E136), L133 (= L141), P135 (= P143), E136 (≠ D144)
- binding coenzyme a: D21 (≠ K21), K22 (≠ A22), A25 (= A25), S61 (≠ A62), I65 (= I66), V103 (≠ M111), F128 (≠ E136), L131 (≠ I139)
Sites not aligning to the query:
3rrvB Crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium paratuberculosis (see paper)
30% identity, 52% coverage: 2:182/348 of query aligns to 6:184/254 of 3rrvB
Sites not aligning to the query:
Q08426 Peroxisomal bifunctional enzyme; PBE; PBFE; L-bifunctional protein; LBP; Multifunctional enzyme 1; MFE1; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 from Homo sapiens (Human) (see 5 papers)
32% identity, 48% coverage: 19:184/348 of query aligns to 17:173/723 of Q08426
- V40 (≠ W41) to G: in dbSNP:rs1062551
- I41 (≠ A42) to R: in dbSNP:rs1062552
- T75 (≠ R83) to I: in dbSNP:rs1062553
- K165 (≠ Y176) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-171; Q-346 and Q-584.
- K171 (≠ H182) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-346 and Q-584.
Sites not aligning to the query:
- 3 E → K: in FRTS3; the mutant is mistargeted to mitochondria; results in impaired mitochondrial oxidative phosphorylation and defects in the transport of fluids across the epithelium of renal proximal tubular cells; dbSNP:rs398124646
- 274 A → T: in dbSNP:rs2302819
- 325 A → G: in dbSNP:rs1062555
- 346 modified: N6-acetyllysine; K→Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-584.
- 584 modified: N6-acetyllysine; alternate; K→Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-346.
- 598 K → T: in dbSNP:rs1042437
- 606 T → P: in dbSNP:rs1042438
Q8GYN9 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; DHNS; Enoyl-CoA hydratase/isomerase D; ECHID; Naphthoate synthase; EC 4.1.3.36 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 49% coverage: 14:185/348 of query aligns to 89:258/337 of Q8GYN9
Sites not aligning to the query:
- 20 H→V: Loss of peroxisomal targeting.
Query Sequence
>GFF1711 FitnessBrowser__Phaeo:GFF1711
MSDIDIRITGRAGRITLTRSKALNALSYDMCMAVDAALKAWADDDAVDLVVMDAEGEKAF
CAGGDIAELYQTGTSGDYDYGRRFWRDEYRMNARIFEYPKPVLSFLQGFVMGGGVGLGCH
GTHRIVGDSTKIAMPEVGIGLIPDVGGTLMLALAPGRLGEYLGLTGARMTAADAIYAGFA
DHYVPETRWPNLISELEQTGRADLLAESAETAPAGTLAPMYDDIGRNFGGETLTDILTAL
DHDDSSFADATLKTLRRNAPLSMAATVELLHRLRLGNMGIRKALELEYRFTHRAMEKGDF
LEGIRAQIIDKDRQPKWQYADRDVPATAVSQMLMPLATQTLQFEEENT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory