Comparing GFF1734 FitnessBrowser__psRCH2:GFF1734 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A959 Glutamate-pyruvate aminotransferase AlaA; EC 2.6.1.2 from Escherichia coli (strain K12) (see paper)
73% identity, 100% coverage: 3:403/403 of query aligns to 4:404/405 of P0A959
4cvqA Crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution (see paper)
73% identity, 100% coverage: 3:403/403 of query aligns to 4:404/404 of 4cvqA
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
41% identity, 98% coverage: 6:399/403 of query aligns to 3:391/393 of 1xi9C
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
31% identity, 91% coverage: 34:399/403 of query aligns to 27:383/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
31% identity, 91% coverage: 34:399/403 of query aligns to 27:383/388 of 1gd9A
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
29% identity, 94% coverage: 23:400/403 of query aligns to 28:384/384 of 1o4sB
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
29% identity, 94% coverage: 20:397/403 of query aligns to 18:394/399 of 6f77A
Q93703 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Caenorhabditis elegans (see 3 papers)
30% identity, 91% coverage: 33:397/403 of query aligns to 75:437/464 of Q93703
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
29% identity, 94% coverage: 20:397/403 of query aligns to 19:395/400 of Q02635
Sites not aligning to the query:
1j32A Aspartate aminotransferase from phormidium lapideum
31% identity, 93% coverage: 24:398/403 of query aligns to 22:384/388 of 1j32A
3tcmA Crystal structure of alanine aminotransferase from hordeum vulgare (see paper)
27% identity, 98% coverage: 8:401/403 of query aligns to 11:474/479 of 3tcmA
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
31% identity, 93% coverage: 24:398/403 of query aligns to 23:382/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
31% identity, 93% coverage: 24:398/403 of query aligns to 23:382/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
31% identity, 93% coverage: 24:398/403 of query aligns to 23:382/382 of 1gc3A
Sites not aligning to the query:
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
31% identity, 93% coverage: 24:398/403 of query aligns to 23:382/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
31% identity, 93% coverage: 24:398/403 of query aligns to 23:382/382 of 1bjwA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
31% identity, 93% coverage: 24:398/403 of query aligns to 23:382/385 of Q56232
Sites not aligning to the query:
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
32% identity, 77% coverage: 24:334/403 of query aligns to 21:327/399 of 5wmhA
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
28% identity, 93% coverage: 23:395/403 of query aligns to 22:393/400 of 6f35A
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
28% identity, 93% coverage: 23:395/403 of query aligns to 32:403/410 of P58350
>GFF1734 FitnessBrowser__psRCH2:GFF1734
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPEEILQDVIRN
LPTAQGYSDSKGLFSARKAIMQYYQQKQVEGVSIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQANWWPDLADIKAKITPNTKALVLINPNNPT
GAVYPKEVLEGMVELARQHKLVLFSDEIYDKILYDDAVHISTASLAPDVLCLTFNGLSKS
YRVAGFRSGWVAISGPKHKAQSYIEGLDILANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTWELLNDIPGISCVKPMGALYAFPRIDPKICPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAIGRIGNFLKTYQQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory