Comparing GFF1736 FitnessBrowser__Phaeo:GFF1736 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
65% identity, 96% coverage: 1:108/112 of query aligns to 151:258/258 of 8i04A
Sites not aligning to the query:
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
66% identity, 96% coverage: 1:108/112 of query aligns to 151:258/258 of 4h7oA
Sites not aligning to the query:
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
72% identity, 85% coverage: 1:95/112 of query aligns to 155:249/250 of 4hzdA
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
64% identity, 96% coverage: 1:108/112 of query aligns to 158:265/272 of 3gvdI
Sites not aligning to the query:
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
63% identity, 96% coverage: 1:108/112 of query aligns to 155:262/262 of 1t3dA
Sites not aligning to the query:
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
68% identity, 82% coverage: 1:92/112 of query aligns to 154:245/246 of 8i09A
Sites not aligning to the query:
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
57% identity, 95% coverage: 1:106/112 of query aligns to 151:256/257 of 1ssqD
Sites not aligning to the query:
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
69% identity, 80% coverage: 1:90/112 of query aligns to 155:244/244 of 8i06A
Sites not aligning to the query:
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
60% identity, 93% coverage: 1:104/112 of query aligns to 156:258/261 of 6wyeA
Sites not aligning to the query:
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
64% identity, 80% coverage: 1:90/112 of query aligns to 154:243/243 of 4n69A
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
64% identity, 80% coverage: 1:90/112 of query aligns to 154:243/243 of 7ra4A
Sites not aligning to the query:
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
63% identity, 80% coverage: 1:90/112 of query aligns to 147:233/233 of 4n6bA
1sstA Serine acetyltransferase- complex with coa (see paper)
57% identity, 80% coverage: 1:90/112 of query aligns to 151:233/233 of 1sstA
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
46% identity, 82% coverage: 1:92/112 of query aligns to 177:270/280 of 7bw9A
Sites not aligning to the query:
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
44% identity, 73% coverage: 1:82/112 of query aligns to 179:268/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
44% identity, 73% coverage: 1:82/112 of query aligns to 177:266/267 of 3q1xA
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 77% coverage: 7:92/112 of query aligns to 89:184/203 of P07464
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
35% identity, 77% coverage: 7:92/112 of query aligns to 88:183/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
35% identity, 77% coverage: 7:92/112 of query aligns to 88:183/201 of 1kruA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
35% identity, 77% coverage: 7:92/112 of query aligns to 88:183/200 of 1krrA
Sites not aligning to the query:
>GFF1736 FitnessBrowser__Phaeo:GFF1736
MIDHAHSIVIGETAVVGDNVSMLHSVTLGGTGKEEEDRHPKIGDGVLIGAGAKVLGNIKV
GHCSRIAAGSVVLQGIPPCKTVAGVPAKIVGEAGCDQPSVSMNQVLGGGKPQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory