SitesBLAST
Comparing GFF1748 FitnessBrowser__Marino:GFF1748 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
48% identity, 100% coverage: 2:256/256 of query aligns to 3:252/252 of Q6WVP7
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
49% identity, 99% coverage: 3:256/256 of query aligns to 3:251/251 of 1zk1A
- active site: G17 (= G17), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding 1-phenylethanone: A93 (= A94), N95 (= N97), Y155 (= Y156), Y189 (≠ F188)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), L16 (≠ V16), I18 (= I18), D37 (= D37), H61 (≠ C62), D62 (= D63), S63 (≠ V64), N89 (= N90), A90 (= A91), I92 (= I93), M140 (≠ L141), Y155 (= Y156), G188 (= G187), I190 (= I189), L194 (= L193)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
49% identity, 99% coverage: 3:256/256 of query aligns to 3:251/251 of 1zjzA
- active site: G17 (= G17), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), L16 (≠ V16), I18 (= I18), D37 (= D37), D62 (= D63), N89 (= N90), A90 (= A91), G91 (= G92), I92 (= I93), Y155 (= Y156), G188 (= G187), I190 (= I189), L194 (= L193)
- binding (1r)-1-phenylethanol: A93 (= A94), N95 (= N97), L152 (≠ I153), Y155 (= Y156)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
49% identity, 99% coverage: 3:256/256 of query aligns to 3:251/251 of 1zjyA
- active site: G17 (= G17), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G13), L16 (≠ V16), G17 (= G17), I18 (= I18), D37 (= D37), D62 (= D63), N89 (= N90), A90 (= A91), G91 (= G92), I92 (= I93), Y155 (= Y156), G188 (= G187), I190 (= I189), L194 (= L193)
- binding (1r)-1-phenylethanol: A93 (= A94), N95 (= N97), L152 (≠ I153), Y155 (= Y156), Y189 (≠ F188)
1zk4A Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and NADP (see paper)
48% identity, 99% coverage: 3:256/256 of query aligns to 3:251/251 of 1zk4A
- active site: G17 (= G17), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding 1-phenylethanone: A93 (= A94), Y155 (= Y156), Y189 (≠ F188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (≠ S15), L16 (≠ V16), I18 (= I18), T36 (≠ L36), G37 (≠ D37), R38 (≠ C38), H61 (≠ C62), D62 (= D63), N89 (= N90), A90 (= A91), G91 (= G92), I92 (= I93), Y155 (= Y156), G188 (= G187), I190 (= I189), T192 (= T191), L194 (= L193)
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
48% identity, 100% coverage: 2:256/256 of query aligns to 2:251/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S143), I143 (= I144), Y155 (= Y156), F205 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (≠ S15), L16 (≠ V16), G17 (= G17), I18 (= I18), R38 (≠ C38), H39 (≠ Q39), D62 (= D63), A63 (≠ V64), N89 (= N90), A90 (= A91), V112 (= V114), M140 (≠ L141), S142 (= S143), Y155 (= Y156), K159 (= K160), P187 (= P186), P189 (≠ F188), I190 (= I189), T192 (= T191), P193 (= P192), L194 (= L193)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
48% identity, 100% coverage: 2:256/256 of query aligns to 4:253/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S143), I145 (= I144), E146 (≠ Y145), Y157 (= Y156), V197 (= V194), F207 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), T17 (≠ S15), I20 (= I18), R40 (≠ C38), H41 (≠ Q39), D64 (= D63), A65 (≠ V64), N91 (= N90), A92 (= A91), V114 (= V114), M142 (≠ L141), S144 (= S143), Y157 (= Y156), K161 (= K160), P189 (= P186), G190 (= G187), P191 (≠ F188), I192 (= I189), T194 (= T191), P195 (= P192), L196 (= L193)
6y0sAAA R-specific alcohol dehydrogenase (see paper)
48% identity, 99% coverage: 3:256/256 of query aligns to 3:251/251 of 6y0sAAA
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
40% identity, 99% coverage: 3:256/256 of query aligns to 4:255/255 of 5itvA
- active site: G18 (= G17), S141 (= S143), Y154 (= Y156), K158 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (≠ V16), G18 (= G17), I19 (= I18), D38 (= D37), I39 (≠ C38), T61 (≠ C62), I63 (≠ V64), N89 (= N90), G91 (= G92), T139 (≠ L141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), I186 (≠ F188), I187 (= I189)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
40% identity, 99% coverage: 2:255/256 of query aligns to 6:252/258 of 4wecA
- active site: G21 (= G17), S143 (= S143), Q154 (≠ I153), Y157 (= Y156), K161 (= K160)
- binding nicotinamide-adenine-dinucleotide: G17 (= G13), A19 (≠ S15), S20 (≠ V16), G21 (= G17), I22 (= I18), D41 (= D37), I42 (≠ C38), V61 (≠ C62), D62 (= D63), V63 (= V64), N89 (= N90), T141 (≠ L141), Y157 (= Y156), K161 (= K160), P187 (= P186), P189 (≠ F188), V190 (≠ I189)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 99% coverage: 4:256/256 of query aligns to 3:248/248 of 4urfB
- active site: G16 (= G17), S142 (= S143), I152 (= I153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ V218), R211 (≠ G219), R212 (≠ H220)
- binding bicarbonate ion: I92 (= I93), G94 (= G95), R109 (≠ H110), R179 (= R180), S228 (= S236)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ S15), N15 (≠ V16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (≠ C38), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), G91 (= G92), I140 (≠ L141), Y155 (= Y156), K159 (= K160), P185 (= P186), A186 (≠ G187), I188 (= I189), T190 (= T191)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 99% coverage: 4:256/256 of query aligns to 3:248/248 of 4urfA
- active site: G16 (= G17), S142 (= S143), I152 (= I153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I93), S93 (≠ A94), G94 (= G95), E95 (≠ A96), T97 (≠ K98), E101 (= E102), T103 (= T104), Q106 (≠ E107), R109 (≠ H110), S175 (≠ T176), G177 (≠ N178)
- binding magnesium ion: S237 (= S245), Y238 (≠ E246)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ S15), N15 (≠ V16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (≠ C38), W41 (≠ E42), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), G91 (= G92), I140 (≠ L141), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (= I189), T190 (= T191)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 99% coverage: 4:256/256 of query aligns to 3:248/248 of 4ureB
- active site: G16 (= G17), S142 (= S143), I152 (= I153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ V16), G16 (= G17), I17 (= I18), N89 (= N90), G91 (= G92), Y155 (= Y156), P185 (= P186), A186 (≠ G187)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
35% identity, 98% coverage: 4:255/256 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (= G17), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (≠ V16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (≠ C38), A61 (≠ C62), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), M140 (≠ L141), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), A186 (≠ G187), Y187 (≠ F188), I188 (= I189), L192 (= L193)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
38% identity, 98% coverage: 4:254/256 of query aligns to 11:257/267 of 3ay6B
- active site: G24 (= G17), S151 (= S143), Y164 (= Y156), K168 (= K160)
- binding beta-D-glucopyranose: E102 (≠ A94), S151 (= S143), H153 (≠ Y145), W158 (≠ A150), Y164 (= Y156), N202 (≠ V194), K205 (≠ H197)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G13), T23 (≠ V16), G24 (= G17), L25 (≠ I18), Y45 (≠ Q39), D71 (= D63), V72 (= V64), N98 (= N90), A99 (= A91), G100 (= G92), V101 (≠ I93), M149 (≠ L141), S151 (= S143), Y164 (= Y156), K168 (= K160), P194 (= P186), G195 (= G187), M197 (≠ I189), T199 (= T191), P200 (= P192), I201 (≠ L193), N202 (≠ V194)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
40% identity, 98% coverage: 4:255/256 of query aligns to 3:250/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G16 (= G17), I17 (= I18), D36 (= D37), L37 (≠ C38), C61 (= C62), D62 (= D63), V63 (= V64), N89 (= N90), A90 (= A91), T140 (≠ L141), S142 (= S143), Y155 (= Y156), K159 (= K160), A186 (≠ G187), V187 (≠ F188)
5h5xC Crystal structure of nadh bound carbonyl reductase from streptomyces coelicolor
38% identity, 98% coverage: 4:255/256 of query aligns to 11:256/257 of 5h5xC
- active site: G24 (= G17), S151 (= S143), Y164 (= Y156), K168 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G13), S23 (≠ V16), G24 (= G17), I25 (= I18), D44 (= D37), F45 (≠ C38), L69 (≠ C62), D70 (= D63), N97 (= N90), A98 (= A91), Y164 (= Y156), K168 (= K160), P194 (= P186), G195 (= G187), I197 (= I189), T199 (= T191)
2hsdA The refined three-dimensional structure of 3alpha,20beta- hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases (see paper)
40% identity, 98% coverage: 4:254/256 of query aligns to 3:242/253 of 2hsdA
- active site: G16 (= G17), S138 (= S143), Y151 (= Y156), K155 (= K160)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), R15 (≠ V16), G16 (= G17), L17 (≠ I18), D36 (= D37), V37 (≠ C38), L58 (≠ C62), V60 (= V64), N86 (= N90), A87 (= A91), S138 (= S143), Y151 (= Y156), K155 (= K160), P181 (= P186), G182 (= G187), T184 (≠ I189)
1hdcA Mechanism of inhibition of 3alpha,20beta-hydroxysteroid dehydrogenase by a licorice-derived steroidal inhibitor (see paper)
40% identity, 98% coverage: 4:254/256 of query aligns to 3:242/253 of 1hdcA
- active site: G16 (= G17), S138 (= S143), Y151 (= Y156), K155 (= K160)
- binding carbenoxolone: S90 (≠ A94), T91 (vs. gap), G92 (= G95), L147 (≠ D152), Y151 (= Y156), M183 (≠ F188), M188 (≠ L193), T189 (= T201), T192 (≠ D204)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
41% identity, 99% coverage: 3:255/256 of query aligns to 3:239/244 of 1nfqA
- active site: G17 (= G17), S139 (= S143), Y152 (= Y156), K156 (= K160)
- binding Androsterone: L91 (≠ A94), E141 (≠ Y145), C149 (≠ I153), Y152 (= Y156), V193 (≠ D204), I197 (≠ A208), F198 (≠ K209)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ V16), G17 (= G17), M18 (≠ I18), D37 (= D37), L39 (≠ Q39), L59 (≠ C62), D60 (= D63), V61 (= V64), N87 (= N90), A88 (= A91), I137 (≠ L141), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), V185 (≠ I189), T187 (= T191), P188 (= P192), M189 (≠ L193), T190 (= T201)
Query Sequence
>GFF1748 FitnessBrowser__Marino:GFF1748
MERLKGKVAVITGGSVGIGAATALRMAEEGAAVAILDCQDSEGEALAKQLEGRGLKAGYW
HCDVSKEQEVKQVLDAVANTFGTPTVLVNNAGIAGANKPTHELTEEEWDHVQDVNVKGVF
FCTKHAIPHMKKAGVGSIINLSSIYGLVSAPDIPPYHASKGAVRLMSKTDALLYATENIR
CNSIHPGFIWTPLVEAHLKTTGQDPEEAKKATAAMHPVGHMGEPDDIAWGAVYLASDESK
FVTGSELVIDGGYTAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory