SitesBLAST
Comparing GFF1761 FitnessBrowser__psRCH2:GFF1761 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
7jsjA Structure of the nact-pf2 complex (see paper)
39% identity, 91% coverage: 34:470/482 of query aligns to 20:448/468 of 7jsjA
- binding sodium ion: S124 (= S142), I127 (≠ V145), S128 (= S146), N129 (= N147), G172 (= G199), T366 (= T388), T369 (= T391), S370 (= S392), N371 (= N393), A413 (= A435), T414 (= T436)
- binding (2R)-2-[2-(4-tert-butylphenyl)ethyl]-2-hydroxybutanedioic acid: N129 (= N147), T130 (= T148), T173 (= T200), G315 (= G337), I316 (≠ V338), N371 (= N393)
Q86YT5 Na(+)/citrate cotransporter; NaCT; Sodium-coupled citrate transporter; Sodium-dependent citrate transporter; Solute carrier family 13 member 5 from Homo sapiens (Human) (see 5 papers)
36% identity, 91% coverage: 34:470/482 of query aligns to 32:542/568 of Q86YT5
- T142 (= T148) to M: in DEE25; no loss of localization to plasma membrane; loss of function in citrate transport; dbSNP:rs761917087
- G219 (= G192) to E: loss of localization to plasma membrane; loss of function in citrate transport; dbSNP:rs150024888; to R: in DEE25; loss of function in citrate transport; loss of localization to plasma membrane; dbSNP:rs144332569
- T227 (= T200) to M: in DEE25; loss of function in citrate transport; no effect on localization to plasma membrane; dbSNP:rs587777577
- D243 (≠ N213) to N: no effect on localization to plasma membrane; no effect on its function in citrate transport; dbSNP:rs142262032
- G409 (= G337) mutation to Q: No effect on its function in citrate transport.
- I410 (≠ V338) mutation I->A,F: Significant loss of function in citrate transport.; mutation to V: No effect on its function in citrate transport.
- L420 (= L348) to P: loss of localization to plasma membrane; loss of function in citrate transport; dbSNP:rs150738356
- S427 (= S355) to L: in DEE25; loss of localization to plasma membrane; loss of function in citrate transport; dbSNP:rs548065551
- L485 (= L413) to R: no effect on localization to plasma membrane; reduced function in citrate transport; increased Km and Vmax values compared with that of wild type with citrate as substrate; dbSNP:rs148049520
- L488 (≠ E416) to P: in DEE25; loss of function in citrate transport; loss of localization to plasma membrane; dbSNP:rs587777578
- D524 (≠ S452) to H: in DEE25; loss of function in citrate transport; no effect on localization to plasma membrane; dbSNP:rs863225448
Sites not aligning to the query:
- 341:568 natural variant: Missing (in DEE25; loss of localization to plasma membrane; loss of function in citrate transport)
- 562 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q28615 Solute carrier family 13 member 2; Na(+)/dicarboxylate cotransporter 1; NaDC-1; Renal sodium/dicarboxylate cotransporter from Oryctolagus cuniculus (Rabbit) (see paper)
33% identity, 87% coverage: 50:470/482 of query aligns to 44:556/593 of Q28615
- L83 (≠ A89) mutation to C: Decreases cell membrane expression. Decreases succinate transport activity. Decreases Km value for succinate.
- T86 (= T92) mutation to C: Does not affect cell membrane localization. Decreases succinate transport activity.
- Y228 (= Y187) mutation to C: Does not affect cell membrane localization. Decreases succinate transport activity.
- Y432 (≠ L346) mutation to C: Does not affect cell membrane localization. Decreases succinate transport activity. Decreases Km value for succinate. More sensitive to inhibition by lithium.
- T474 (= T388) mutation to C: Does not affect cell membrane localization. Abolishes succinate transport activity.
- N525 (= N439) mutation to C: Decreases cell membrane expression. Decreases succinate transport activity.
- M539 (= M453) mutation to C: Does not affect cell membrane localization. Decreases succinate transport activity. Insensitive to inhibition by lithium.
6okzB Structure of vcindy bound to fumarate
39% identity, 89% coverage: 43:469/482 of query aligns to 29:436/444 of 6okzB
7t9gA Structure of vcindy-na+ (see paper)
39% identity, 89% coverage: 43:469/482 of query aligns to 30:437/445 of 7t9gA
6wtxA Structure of vcindy in complex with terephthalate (see paper)
39% identity, 89% coverage: 43:469/482 of query aligns to 30:437/445 of 6wtxA
- binding sodium ion: S129 (= S142), S133 (= S146), N134 (= N147), G176 (= G193), G182 (= G199), T356 (= T388), A359 (≠ T391), S360 (= S392), N361 (= N393), A403 (= A435)
- binding terephthalic acid: N134 (= N147), S183 (≠ T200), S360 (= S392), N361 (= N393), T362 (= T394), T404 (= T436)
4f35B Crystal structure of a bacterial dicarboxylate/sodium symporter (see paper)
38% identity, 89% coverage: 43:469/482 of query aligns to 29:406/414 of 4f35B
Query Sequence
>GFF1761 FitnessBrowser__psRCH2:GFF1761
MSDSPQNKGAAIAASIGLFLGPLLLLLCILTEPPADLSRTAWLTVGMAALMAVWWSTEAI
PIPATSLLPILLIPVLGIDTLAKATAPYANPTIFLFLGGFLLGLAMQRWNLHKRIALATL
LAVGSAPSRQIAGFMIATAFISMWVSNTATSIMMLPIGLSVISLLVAGSDKRDGERFAIA
LLLGIAYAASVGGIATLIGTPPNALLAAFLRENYDVHIGFGQWMLLGLPVSLGMLLFIWW
WLTRGGFTLSGGDSRAMLEKEMAALGPMSKAEKMVAVVFSLAALAWIFQPLLAKHVNGVN
DTSIAMAAALSLFLIPVDLRQRVFLMDWEQANKAPWGVLLLFGGGLSLAGVIGASGLAQW
IAQSLGGFGALPLILMIGLVALVITFLTEITSNTATAAAFLPLLGALAVAQGLSPEMLAI
PAAIAASCAFMMPVATPPNAIVFGTGQMHIQSMIKAGFAINLFGVALVTLLCYGLVGLIW
AS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory