SitesBLAST
Comparing GFF1784 FitnessBrowser__psRCH2:GFF1784 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6x3bB Structure of rmd from pseudomonas aeruginosa complexed with NADPH
26% identity, 97% coverage: 2:306/313 of query aligns to 3:287/297 of 6x3bB
- active site: S104 (= S114), G105 (≠ I115), D106 (≠ K116), Y130 (= Y140), K134 (= K144)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), S10 (≠ N9), G11 (= G10), F12 (= F11), V13 (≠ L12), D38 (≠ A42), L39 (≠ T43), L59 (≠ A68), A60 (= A69), G61 (≠ A70), T63 (≠ A72), I102 (= I112), Y130 (= Y140), K134 (= K144), H160 (≠ V170), Q165 (≠ V175)
- binding pyrophosphate 2-: D106 (≠ K116), R199 (= R201)
6x3bA Structure of rmd from pseudomonas aeruginosa complexed with NADPH
25% identity, 97% coverage: 2:306/313 of query aligns to 7:290/300 of 6x3bA
- active site: S108 (= S114), G109 (≠ I115), D110 (≠ K116), Y134 (= Y140), K138 (= K144)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G7), S14 (≠ N9), G15 (= G10), F16 (= F11), V17 (≠ L12), D42 (≠ A42), L43 (≠ T43), L63 (≠ A68), A64 (= A69), G65 (≠ A70), T67 (≠ A72), Y134 (= Y140), K138 (= K144), H164 (≠ V170), Q169 (≠ V175)
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
25% identity, 98% coverage: 3:308/313 of query aligns to 10:307/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G7), G17 (= G10), F18 (= F11), I19 (≠ L12), D37 (= D24), N38 (≠ R25), E40 (≠ T27), R41 (≠ L28), N61 (≠ D48), V62 (≠ L49), A81 (= A68), A82 (= A69), A83 (= A70), F124 (≠ I112), K154 (= K144), P177 (= P167), N179 (≠ L169)
- binding uridine-5'-diphosphate: R147 (vs. gap), G189 (≠ F179), A190 (= A180), M194 (vs. gap), Y205 (≠ L192), I206 (≠ P193), F207 (= F194), R214 (= R201), I251 (≠ L241)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
25% identity, 100% coverage: 1:313/313 of query aligns to 1:310/313 of 6bwlA
- active site: T122 (≠ S114), C123 (≠ I115), M124 (≠ K116), Y147 (= Y140), K151 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ L12), D31 (≠ S29), N32 (≠ C30), L33 (≠ A31), N35 (≠ R33), S36 (= S34), D57 (= D54), I58 (≠ W55), L79 (≠ A68), A80 (= A69), A81 (= A70), I83 (≠ A72), M120 (≠ I112), K151 (= K144), N176 (≠ L169), T177 (≠ V170)
- binding uridine-5'-diphosphate: N176 (≠ L169), G189 (= G177), V190 (≠ N178), N205 (≠ P193), I206 (vs. gap), Y207 (≠ F194), Q212 (≠ N199), R214 (= R201), I250 (≠ M248), E275 (≠ M274)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
24% identity, 99% coverage: 1:310/313 of query aligns to 1:302/309 of 4zrnA
- active site: T117 (≠ S114), G119 (vs. gap), A120 (≠ K116), Y143 (= Y140), K147 (= K144), Y181 (vs. gap), G185 (= G177)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ L12), D31 (≠ S34), N32 (≠ P35), S34 (≠ A37), S35 (≠ Q38), G36 (≠ V39), S51 (≠ D54), I52 (≠ W55), L73 (≠ A68), A74 (= A69), A75 (= A70), T92 (≠ V89), S115 (≠ I112), S116 (= S113), Y143 (= Y140), K147 (= K144), Y170 (≠ P167), V173 (= V170)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S114), G119 (vs. gap), A120 (≠ K116), Y143 (= Y140), N172 (≠ L169), G185 (= G177), V186 (≠ N178), H201 (≠ P193), F203 (= F194), Y208 (≠ N199), R210 (= R201), V244 (≠ T237), R267 (≠ K271), D270 (≠ M274)
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
37% identity, 52% coverage: 3:166/313 of query aligns to 2:158/321 of 4id9A
- active site: S106 (= S114), Y132 (= Y140), K136 (= K144)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), R10 (≠ F11), V11 (≠ L12), D30 (≠ A31), L31 (≠ V32), R32 (= R33), S44 (≠ D48), L45 (= L49), L64 (≠ A68), A66 (= A70), V81 (= V89), S106 (= S114), Y132 (= Y140), K136 (= K144)
Sites not aligning to the query:
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
37% identity, 52% coverage: 3:166/313 of query aligns to 3:159/328 of 4id9B
- active site: S107 (= S114), Y133 (= Y140), K137 (= K144)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), R11 (≠ F11), V12 (≠ L12), D31 (≠ A31), L32 (≠ V32), S45 (≠ D48), L46 (= L49), L65 (≠ A68), A67 (= A70), V82 (= V89), Y133 (= Y140), K137 (= K144)
Sites not aligning to the query:
2ydxE Crystal structure of human s-adenosylmethionine synthetase 2, beta subunit (see paper)
29% identity, 59% coverage: 3:188/313 of query aligns to 5:177/312 of 2ydxE
- binding resveratrol: E42 (≠ A42), A51 (≠ G51), H54 (≠ D54), D58 (≠ P58), R71 (= R71), R72 (≠ A72), S110 (= S114), D111 (≠ I115), Y133 (= Y140), I158 (≠ L169), A170 (≠ S181)
- binding 1,4,5,6-tetrahydronicotinamide adenine dinucleotide phosphate: G9 (= G7), T11 (≠ N9), G12 (= G10), L13 (≠ F11), L14 (= L12), F34 (≠ V32), R35 (= R33), R36 (≠ S34), V44 (≠ F44), N45 (≠ A45), L46 (≠ V46), C67 (≠ H67), A68 (= A68), A69 (= A69), R71 (= R71), L86 (≠ V89), I108 (= I112), Y133 (= Y140), K137 (= K144), I156 (≠ P167), P157 (= P168), L159 (≠ V170)
Sites not aligning to the query:
2ydxA Crystal structure of human s-adenosylmethionine synthetase 2, beta subunit (see paper)
29% identity, 59% coverage: 3:188/313 of query aligns to 5:177/312 of 2ydxA
- binding calcium ion: D111 (≠ I115)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G7), T11 (≠ N9), G12 (= G10), L13 (≠ F11), L14 (= L12), F34 (≠ V32), R35 (= R33), R36 (≠ S34), V44 (≠ F44), L46 (≠ V46), C67 (≠ H67), A69 (= A69), R71 (= R71), L86 (≠ V89), I108 (= I112), Y133 (= Y140), K137 (= K144), I156 (≠ P167), P157 (= P168), I158 (≠ L169), L159 (≠ V170)
- binding resveratrol: E42 (≠ A42), N50 (≠ C50), A51 (≠ G51), H54 (≠ D54), D58 (≠ P58), R71 (= R71), S110 (= S114), D111 (≠ I115), Y112 (≠ K116), Y133 (= Y140), I158 (≠ L169), E167 (≠ N178), A170 (≠ S181)
Sites not aligning to the query:
1kewA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with thymidine diphosphate bound (see paper)
22% identity, 99% coverage: 1:310/313 of query aligns to 1:332/361 of 1kewA
- active site: T133 (≠ S114), D134 (≠ I115), E135 (≠ K116), L152 (≠ T122), L154 (= L124), F155 (= F128), T158 (≠ S131), Y167 (= Y140), K171 (= K144)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (≠ L12), D32 (= D24), K33 (≠ R25), L34 (≠ I26), T35 (= T27), A37 (≠ S29), G38 (≠ C30), D58 (= D48), I59 (≠ L49), L80 (≠ A68), A81 (= A69), A82 (= A70), S84 (≠ A72), T99 (≠ Y86), I131 (= I112), S132 (= S113), T133 (≠ S114), Y167 (= Y140), K171 (= K144), C194 (≠ P167), N196 (≠ L169), N197 (≠ V170)
- binding thymidine-5'-diphosphate: E135 (≠ K116), N196 (≠ L169), K206 (= K184), L207 (= L185), P222 (= P193), Y224 (≠ F194), R231 (= R201), N266 (≠ T237), R297 (≠ K271), H300 (≠ M274)
Sites not aligning to the query:
1keuA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with dtdp-d-glucose bound (see paper)
22% identity, 99% coverage: 1:310/313 of query aligns to 1:332/361 of 1keuA
- active site: T133 (≠ S114), D134 (≠ I115), E135 (≠ K116), L152 (≠ T122), L154 (= L124), F155 (= F128), T158 (≠ S131), Y167 (= Y140), K171 (= K144)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S84 (≠ A72), T133 (≠ S114), D134 (≠ I115), E135 (≠ K116), Y167 (= Y140), N196 (≠ L169), K206 (= K184), L207 (= L185), P222 (= P193), Y224 (≠ F194), R231 (= R201), N266 (≠ T237), R297 (≠ K271), H300 (≠ M274)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (≠ L12), D32 (= D24), K33 (≠ R25), L34 (≠ I26), T35 (= T27), G38 (≠ C30), D58 (= D48), L80 (≠ A68), A81 (= A69), A82 (= A70), S84 (≠ A72), T99 (≠ Y86), S132 (= S113), T133 (≠ S114), Y167 (= Y140), K171 (= K144), C194 (≠ P167), N196 (≠ L169), N197 (≠ V170)
Sites not aligning to the query:
P26391 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
22% identity, 99% coverage: 1:310/313 of query aligns to 1:332/361 of P26391
Sites not aligning to the query:
Q9FX01 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1; At3BETAHSD/D1; 4alpha-carboxysterol-C3-dehydrogenase/C4-decarboxylase isoform 1-1; Reticulon-like protein B24; AtRTNLB24; Sterol-4-alpha-carboxylate 3-dehydrogenase 1, decarboxylating; EC 1.1.1.418 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 98% coverage: 4:310/313 of query aligns to 13:356/439 of Q9FX01
- D41 (vs. gap) Essential for the 3betaHSD/D activity; mutation to V: Lost activity.
- D72 (= D48) Essential for the 3betaHSD/D activity; mutation D->A,V: Lost activity.
- T131 (≠ I112) Essential for the 3betaHSD/D activity; mutation to V: Lost activity.
- S133 (= S114) mutation to A: Reduced activity with slower catalysis and lower substrate binding.
- S135 (≠ K116) mutation to A: Normal activity, but slower catalysis with 4alpha-carboxysterol as substrate.; mutation to T: Altered activity due to reduced affinity and catalysis and leading to lower amount of C4-demethylated sterols and higher quantities of 4,4-dimethylated sterol intermediates, and a higher ratio of 4,4-dimethylsterols to 4alpha-methylsterols.; mutation to Y: Altered activity leading to an exclusive production of C4-methylated sterols and 4alpha-carboxy-3beta-hydroxy sterols.
- Y161 (= Y140) Essential for the 3betaHSD/D activity; mutation to F: Lost activity.
- K165 (= K144) Essential for the 3betaHSD/D activity; mutation to I: Lost activity.
- R320 (≠ Q283) mutation to I: Normal activity.
- R328 (vs. gap) Essential for the 3betaHSD/D activity; mutation to I: Lost activity.
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
23% identity, 98% coverage: 3:310/313 of query aligns to 4:329/355 of P27830
- FI 12:13 (≠ FL 11:12) binding
- DKLT 33:36 (≠ DRIT 24:27) binding
- DI 59:60 (≠ DL 48:49) binding
- T100 (≠ V89) binding
- D135 (≠ I115) active site, Proton donor
- E136 (≠ K116) active site, Proton acceptor
- Y160 (= Y140) active site, Proton acceptor
- YSASK 160:164 (≠ YGLSK 140:144) binding
- N190 (≠ V170) binding
6kv9A Moee5 in complex with udp-glucuronic acid and NAD (see paper)
29% identity, 77% coverage: 2:241/313 of query aligns to 2:239/299 of 6kv9A
- active site: S110 (= S114), S111 (≠ I115), S112 (≠ K116), Y133 (= Y140), K137 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (≠ L12), D31 (≠ A31), R32 (= R33), R33 (≠ S34), D47 (= D48), L48 (= L49), L66 (≠ A68), A67 (= A69), A68 (= A70), P70 (≠ A72), C85 (≠ V89), A108 (≠ I112), S109 (= S113), K137 (= K144), F162 (≠ P167), T164 (≠ L169), V165 (= V170), R171 (≠ K176), M174 (≠ F179)
- binding uridine-5'-diphosphate-glucuronic acid: P70 (≠ A72), R73 (≠ M75), S110 (= S114), S111 (≠ I115), Y133 (= Y140), T164 (≠ L169), R171 (≠ K176), M174 (≠ F179), F175 (vs. gap), R178 (≠ S181), E190 (≠ P193), I191 (vs. gap), Y192 (≠ F194), Q197 (≠ N199), R199 (= R201), V235 (≠ T237)
Sites not aligning to the query:
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
32% identity, 53% coverage: 1:166/313 of query aligns to 1:176/338 of 1udaA
- active site: S124 (= S114), A125 (≠ I115), T126 (≠ K116), Y149 (= Y140), K153 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (≠ F11), I12 (≠ L12), D31 (≠ S29), N32 (vs. gap), L33 (vs. gap), C34 (= C30), N35 (≠ A31), S36 (≠ V32), D58 (= D48), I59 (≠ L49), F80 (≠ A68), A81 (= A69), G82 (≠ A70), K84 (≠ A72), S122 (≠ I112), Y149 (= Y140), K153 (= K144)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (≠ K116)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: 179, 199, 200, 216, 217, 218, 231, 233, 292, 295, 299
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
32% identity, 53% coverage: 1:166/313 of query aligns to 1:176/338 of 1naiA
- active site: S124 (= S114), A125 (≠ I115), T126 (≠ K116), Y149 (= Y140), K153 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (≠ F11), I12 (≠ L12), D31 (≠ S29), N32 (vs. gap), L33 (vs. gap), C34 (= C30), N35 (≠ A31), S36 (≠ V32), D58 (= D48), I59 (≠ L49), F80 (≠ A68), A81 (= A69), G82 (≠ A70), K84 (≠ A72), Y149 (= Y140), K153 (= K144)
- binding 1,3-propandiol: N35 (≠ A31), K84 (≠ A72)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding 1,3-propandiol: 191, 193
- binding uridine-5'-diphosphate: 179, 199, 200, 215, 216, 231, 233, 292
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
32% identity, 53% coverage: 1:166/313 of query aligns to 1:176/338 of 1lrjA
- active site: S124 (= S114), A125 (≠ I115), T126 (≠ K116), Y149 (= Y140), K153 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (≠ F11), I12 (≠ L12), D31 (≠ S29), N32 (vs. gap), L33 (vs. gap), C34 (= C30), N35 (≠ A31), S36 (≠ V32), D58 (= D48), I59 (≠ L49), F80 (≠ A68), A81 (= A69), G82 (≠ A70), K84 (≠ A72), Y149 (= Y140), K153 (= K144)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (≠ I74), S124 (= S114)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-diphosphate-n-acetylglucosamine: 178, 179, 200, 215, 216, 218, 231, 233, 269, 292, 295
G4MVZ2 Polyketide synthase-nonribosomal peptide synthetase ACE1; PKS-NRPS ACE1; ACE1 cytochalasan biosynthesis cluster protein ACE1; Avirulence conferring enzyme; EC 2.3.1.-; EC 6.3.2.- from Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae) (see paper)
31% identity, 68% coverage: 3:215/313 of query aligns to 3717:3948/4034 of G4MVZ2
Sites not aligning to the query:
- 183 C→A: Abolishes recognition of the fungus by resistant rice plants.
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
32% identity, 53% coverage: 1:166/313 of query aligns to 1:176/338 of 2udpA
- active site: S124 (= S114), A125 (≠ I115), T126 (≠ K116), Y149 (= Y140), K153 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (≠ F11), I12 (≠ L12), D31 (≠ S29), N32 (vs. gap), L33 (vs. gap), C34 (= C30), N35 (≠ A31), S36 (≠ V32), D58 (= D48), I59 (≠ L49), F80 (≠ A68), A81 (= A69), G82 (≠ A70), K84 (≠ A72), S122 (≠ I112), S124 (= S114), Y149 (= Y140), K153 (= K144)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177
- binding phenyl-uridine-5'-diphosphate: 179, 199, 200, 216, 217, 218, 231, 233, 269, 292, 295
Query Sequence
>GFF1784 FitnessBrowser__psRCH2:GFF1784
MNVLLTGANGFLGRAIVAHLCRQDRITLSCAVRSPLAQVRFATFAVGDLCGANDWSQPLL
GQQVVIHAAARAHIMKDELADPLSEYRLVNVEGTLNLARQAAAAGVERFIYISSIKVNGE
STPLGKPFVSSDAPAPEDPYGLSKLEAEQGLMQLAAETGMEVVIIRPPLVYGPGVKGNFA
SMIKLIDRGIPLPFGAIHNKRSLVGVDNLVDLIIRCVDHPAAANQIFLAGDGKDLSTTEL
LLGVGKAMDKPAKLIPAPAGFLQLGATLLGKKAMAQRLLGSLQVDISKTCELLDWKPPYT
VEEGLRRCFEPVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory