Comparing GFF1785 FitnessBrowser__WCS417:GFF1785 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
29% identity, 99% coverage: 1:266/270 of query aligns to 1:259/261 of 2xuaH
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
32% identity, 95% coverage: 11:266/270 of query aligns to 17:267/274 of 4uhdA
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
32% identity, 95% coverage: 11:266/270 of query aligns to 17:267/272 of 4uheA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
32% identity, 95% coverage: 11:266/270 of query aligns to 17:267/278 of 4uhfA
3ia2A Pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog (see paper)
29% identity, 96% coverage: 7:266/270 of query aligns to 7:269/271 of 3ia2A
P22862 Arylesterase; Aryl-ester hydrolase; Carboxylic acid perhydrolase; PFE; Putative bromoperoxidase; EC 3.1.1.2; EC 1.-.-.- from Pseudomonas fluorescens (see 5 papers)
29% identity, 96% coverage: 7:266/270 of query aligns to 8:270/272 of P22862
Sites not aligning to the query:
8pi1B Bicyclic incypro pseudomonas fluorescens esterase (see paper)
28% identity, 98% coverage: 7:270/270 of query aligns to 7:273/276 of 8pi1B
Sites not aligning to the query:
3heaA The l29p/l124i mutation of pseudomonas fluorescens esterase (see paper)
29% identity, 96% coverage: 7:266/270 of query aligns to 7:269/271 of 3heaA
3hi4A Switching catalysis from hydrolysis to perhydrolysis in p. Fluorescens esterase (see paper)
29% identity, 96% coverage: 7:266/270 of query aligns to 7:269/271 of 3hi4A
6yl4A Soluble epoxide hydrolase in complex with 3-((r)-3-(1-hydroxyureido) but-1-yn-1-yl)-n-((s)-3-phenyl-3-(4-trifluoromethoxy)phenyl)propyl) benzamide (see paper)
32% identity, 44% coverage: 11:128/270 of query aligns to 22:142/319 of 6yl4A
Sites not aligning to the query:
6hgxA Soluble epoxide hydrolase in complex with 1-(4-((4-(tert-butyl) morpholin-2-yl)methoxy)phenyl)-3-cyclohexylurea (see paper)
32% identity, 44% coverage: 11:128/270 of query aligns to 22:142/319 of 6hgxA
Sites not aligning to the query:
6hgwA Soluble epoxide hydrolase in complex with 2-(4-fluorophenyl)-n-(4- phenoxybenzyl)ethanamine
32% identity, 44% coverage: 11:128/270 of query aligns to 22:142/319 of 6hgwA
Sites not aligning to the query:
6hgvA Soluble epoxide hydrolase in complex with talinolol (see paper)
32% identity, 44% coverage: 11:128/270 of query aligns to 22:142/319 of 6hgvA
Sites not aligning to the query:
6fr2A Soluble epoxide hydrolase in complex with lk864 (see paper)
32% identity, 44% coverage: 11:128/270 of query aligns to 22:142/319 of 6fr2A
Sites not aligning to the query:
8qn0A Soluble epoxide hydrolase in complex with rk3 (see paper)
32% identity, 44% coverage: 11:128/270 of query aligns to 25:145/322 of 8qn0A
Sites not aligning to the query:
8qmzA Soluble epoxide hydrolase in complex with rk4 (see paper)
32% identity, 44% coverage: 11:128/270 of query aligns to 23:143/320 of 8qmzA
Sites not aligning to the query:
5alrA Ligand complex structure of soluble epoxide hydrolase (see paper)
32% identity, 44% coverage: 11:128/270 of query aligns to 249:369/542 of 5alrA
Sites not aligning to the query:
5am5A Ligand complex structure of soluble epoxide hydrolase (see paper)
32% identity, 44% coverage: 11:128/270 of query aligns to 249:369/546 of 5am5A
Sites not aligning to the query:
5am4A Ligand complex structure of soluble epoxide hydrolase (see paper)
32% identity, 44% coverage: 11:128/270 of query aligns to 249:369/546 of 5am4A
Sites not aligning to the query:
5am1A Ligand complex structure of soluble epoxide hydrolase (see paper)
32% identity, 44% coverage: 11:128/270 of query aligns to 249:369/546 of 5am1A
Sites not aligning to the query:
>GFF1785 FitnessBrowser__WCS417:GFF1785
MPVAVIDGQPLHYVDQGTGPVVLLGSSYLWDADMWSPQIEALSQQYRVIVPELWGHGESA
SLPAQTRSLDDLARQALTLIDQLDIAQINLVGLSVGGMWGARLALRAPERINSLVLMDTY
LGAEPEATRQYYFSLFKMIEDAGAIPEPLLDVVAPIFFRPGIDRESALYQDFRKQLQGYS
KERLLQSIVPLGRLIFSREDILEQLPRLDADTTLVMCGEQDKPRPPAESEEMAGLIGCSL
ILIPEAGHISARENPDFVNEALLTFLANNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory