Comparing GFF1854 Psest_1893 glucokinase, proteobacterial type to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1sz2B Crystal structure of e. Coli glucokinase in complex with glucose (see paper)
43% identity, 98% coverage: 4:317/320 of query aligns to 4:316/320 of 1sz2B
6vzzA Crystal structure of glucokinase from balamuthia mandrillaris in complex with glucose (see paper)
27% identity, 89% coverage: 8:293/320 of query aligns to 30:343/374 of 6vzzA
8dtcA Crystal structure of glucokinase with bound glucose from acanthamoeba castellanii
24% identity, 78% coverage: 8:256/320 of query aligns to 30:313/374 of 8dtcA
>GFF1854 Psest_1893 glucokinase, proteobacterial type
MSTALVGDIGGTNARFALWRDQRIEQIRVLPTADYASPELAIRAYLREVDQPLDALEAVC
LACAGPVGGDLFRFTNNHWQLSREAFCRELGVKELLLINDFTAMALGMTRLHDGERITVC
QGEPEPGRPRLVIGPGTGLGVAGLLPLSGGGWRALPGEGGHICLPIGSEREAAIWAHLHR
SQGHVNAEAVLSGPGLLTLYRACCALDGQQVEFDSPAAITKAALAGDAYATAVLEQFCRW
LGRIVGDNVLTLGARGGVYIVGGVVPRFAEMFLRSGFSEALREKGQMSRYFDRLPVWLVT
APYPGLEGAGVALQPLLEGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory