Comparing GFF1857 FitnessBrowser__psRCH2:GFF1857 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
5dvjA Crystal structure of galactose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
72% identity, 95% coverage: 22:415/415 of query aligns to 3:396/396 of 5dvjA
5dviA High resolution crystal structure of glucose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
72% identity, 95% coverage: 22:415/415 of query aligns to 3:396/396 of 5dviA
4r2bA Crystal structure of sugar transporter oant_3817 from ochrobactrum anthropi, target efi-510528, with bound glucose
48% identity, 94% coverage: 24:415/415 of query aligns to 7:395/395 of 4r2bA
8hqqA Crystal structure of the glucose-binding protein sar11_0769 from "candidatus pelagibacter ubique" htcc1062 bound to glucose
50% identity, 90% coverage: 21:394/415 of query aligns to 2:378/398 of 8hqqA
2b3fA Thermus thermophilus glucose/galactose binding protein bound with galactose (see paper)
34% identity, 86% coverage: 23:377/415 of query aligns to 2:352/392 of 2b3fA
2b3bC Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
34% identity, 86% coverage: 23:377/415 of query aligns to 2:352/392 of 2b3bC
2b3bA Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
34% identity, 86% coverage: 23:377/415 of query aligns to 2:352/392 of 2b3bA
7ehqA Chitin oligosaccharide binding protein (see paper)
27% identity, 53% coverage: 70:290/415 of query aligns to 55:278/406 of 7ehqA
Sites not aligning to the query:
3vxcA Crystal structure of xylobiose-bxle complex from streptomyces thermoviolaceus opc-520
28% identity, 53% coverage: 71:290/415 of query aligns to 48:276/398 of 3vxcA
Sites not aligning to the query:
4g68A Biochemical and structural insights into xylan utilization by the thermophilic bacteriumcaldanaerobius polysaccharolyticus (see paper)
29% identity, 49% coverage: 86:290/415 of query aligns to 56:269/392 of 4g68A
Sites not aligning to the query:
4c1tA Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. Lactis bl-04 in complex with arabinoxylotriose (see paper)
30% identity, 34% coverage: 125:264/415 of query aligns to 105:248/396 of 4c1tA
Sites not aligning to the query:
3oo6A Crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose (see paper)
28% identity, 52% coverage: 72:285/415 of query aligns to 50:256/390 of 3oo6A
Sites not aligning to the query:
7c0kB Crystal structure of a dinucleotide-binding protein of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) (see paper)
24% identity, 76% coverage: 25:340/415 of query aligns to 20:321/397 of 7c0kB
Sites not aligning to the query:
7c0kA Crystal structure of a dinucleotide-binding protein of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) (see paper)
24% identity, 76% coverage: 25:340/415 of query aligns to 19:320/396 of 7c0kA
Sites not aligning to the query:
7c0oB Crystal structure of a dinucleotide-binding protein (y56f) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (see paper)
24% identity, 76% coverage: 25:340/415 of query aligns to 19:320/397 of 7c0oB
Sites not aligning to the query:
7vfqC Wild type glta from bifidobacterium infantis jcm 1222 complexed with lacto-n-tetraose
31% identity, 25% coverage: 70:174/415 of query aligns to 51:152/397 of 7vfqC
Sites not aligning to the query:
2gh9A Thermus thermophilus maltotriose binding protein bound with maltotriose (see paper)
25% identity, 45% coverage: 155:341/415 of query aligns to 125:310/378 of 2gh9A
Sites not aligning to the query:
>GFF1857 FitnessBrowser__psRCH2:GFF1857
MNAFHRLALSVSLALPVLAHAGEVEVLHWWTSGGEKRAADTLQKLVEQKGHSWKDFAVAG
GGGEAAMTVLKTRAVSGNPPSAAQIKGPDIQEWGELGLLANLDDTAKAERWDALLPEQVR
KIMQYDGSYVAVPVNVHRVNWLWINPEVFEKAGAKPPKTLDEFFAAADKLKAAGFIPVAH
GGQPWQDGTVFEGFVLSILGPDDYHKAFVELDNDTLTGDKMVQAFTALKKLRDYIDADAA
GREWNRATGMVIDGKAGMQIMGDWAKSEFTAANKVAGKNYQCLPFPGTQGSFAFNIDSLA
MFKLSSDDNRKAQEDLARTVLEPEFQTFFNQNKGSIPVRQDQDMSEFDACAQQSMTDFKE
AAKGSGLQPSLTHGMAASSYVQGAVFDVVTNFFNDPKADPQKAAKQLAAAIKAVQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory