Comparing GFF1858 FitnessBrowser__psRCH2:GFF1858 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
27% identity, 90% coverage: 20:295/305 of query aligns to 6:276/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
27% identity, 85% coverage: 20:278/305 of query aligns to 28:286/313 of P94529
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
24% identity, 84% coverage: 37:292/305 of query aligns to 223:488/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
26% identity, 68% coverage: 85:292/305 of query aligns to 285:503/514 of P02916
>GFF1858 FitnessBrowser__psRCH2:GFF1858
MSSIALQARPAKASPLDALQRWLPKLVLAPSMLIVLVGFYAYIGWTFLLSFTNSRFMPSY
KWVGLQQYERLWDNDRWWVASQNLLVFGGLFIAVSLIIGVVLAVLLDQRIRREGLIRTIY
LYPMALSMIVTGTAWQWLLNPGLGLDKLLRDWGWEGFRFDWLVDPDRVIYCLVIAAVWQA
SGFVMALFLAGLRSVDQSIIRAAQVDGASLPTIYLRIVLPSLRPVFFSALMILAHIAIKS
FDLVAAMTAGGPGYSSDLPAMFMYAHTFTRGQMGLGAASAMLMLGAVMAIIVPYLYSELR
NKRHV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory