Comparing GFF1874 FitnessBrowser__Marino:GFF1874 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bntC X-ray crystal structure of a aspartate-semialdehyde dehydrogenase bound to NADP from pseudomonas aeruginosa
70% identity, 100% coverage: 1:360/360 of query aligns to 13:371/371 of 5bntC
Sites not aligning to the query:
P44801 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
68% identity, 99% coverage: 1:357/360 of query aligns to 12:369/371 of P44801
Sites not aligning to the query:
1pquA Crystal structure of the h277n mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with NADP, s-methyl cysteine sulfoxide and cacodylate (see paper)
68% identity, 99% coverage: 1:357/360 of query aligns to 12:369/371 of 1pquA
Sites not aligning to the query:
3pzrA Crystals structure of aspartate beta-semialdehyde dehydrogenase from vibrio cholerae with NADP and product of s-carbamoyl-l-cysteine (see paper)
69% identity, 99% coverage: 1:357/360 of query aligns to 11:366/370 of 3pzrA
Sites not aligning to the query:
Q9KQG2 Aspartate-semialdehyde dehydrogenase 1; ASA dehydrogenase 1; ASADH 1; Aspartate-beta-semialdehyde dehydrogenase 1; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
69% identity, 99% coverage: 1:357/360 of query aligns to 11:366/370 of Q9KQG2
Sites not aligning to the query:
4r5mA Crystal structure of vc-aspartate beta-semialdehyde-dehydrogenase with NADP and 4-nitro-2-phosphono-benzoic acid (see paper)
69% identity, 99% coverage: 1:357/360 of query aligns to 11:366/369 of 4r5mA
Sites not aligning to the query:
1mb4A Crystal structure of aspartate semialdehyde dehydrogenase from vibrio cholerae with NADP and s-methyl-l-cysteine sulfoxide (see paper)
69% identity, 99% coverage: 1:357/360 of query aligns to 11:366/369 of 1mb4A
Sites not aligning to the query:
7tcmA Crystal structure of aspartate-semialdehyde dehydrogenase from acinetobacter baumannii in complex with NADP
67% identity, 100% coverage: 1:359/360 of query aligns to 13:370/373 of 7tcmA
Sites not aligning to the query:
1tb4A Crystal structure of aspartate-semialdehyde dehydrogenase from haemophilus influenzae with a bound periodate (see paper)
67% identity, 99% coverage: 1:357/360 of query aligns to 12:355/357 of 1tb4A
1ta4A Crystal structure of aspartate-semialdehyde dehydrogenase from haemophilus influenzae with a bound arsenate (see paper)
67% identity, 99% coverage: 1:357/360 of query aligns to 12:355/357 of 1ta4A
1nx6A Crystal structure of aspartate semialdehyde dehydrogenase from haemophilus influenzae as a tetrahedral hemithiocetal reaction intermediate with phosphate at 2.15 a (see paper)
67% identity, 99% coverage: 1:357/360 of query aligns to 12:355/357 of 1nx6A
1pqpA Crystal structure of the c136s mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with aspartate semialdehyde and phosphate (see paper)
66% identity, 99% coverage: 1:357/360 of query aligns to 12:355/357 of 1pqpA
1gl3A Aspartate beta-semialdehyde dehydrogenase in complex with NADP and substrate analogue s-methyl cysteine sulfoxide (see paper)
66% identity, 99% coverage: 1:357/360 of query aligns to 12:366/367 of 1gl3A
Sites not aligning to the query:
P0A9Q9 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Escherichia coli (strain K12) (see 2 papers)
66% identity, 99% coverage: 1:357/360 of query aligns to 12:366/367 of P0A9Q9
Sites not aligning to the query:
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
29% identity, 77% coverage: 85:360/360 of query aligns to 91:343/357 of 4r54A
Sites not aligning to the query:
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
29% identity, 77% coverage: 85:360/360 of query aligns to 91:343/357 of 4r41A
Sites not aligning to the query:
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
29% identity, 77% coverage: 85:360/360 of query aligns to 91:343/357 of 4r3nA
Sites not aligning to the query:
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
29% identity, 77% coverage: 85:360/360 of query aligns to 91:343/357 of 3q1lA
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
29% identity, 77% coverage: 85:360/360 of query aligns to 91:343/357 of 3pwsA
Sites not aligning to the query:
3pwkA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
29% identity, 77% coverage: 85:360/360 of query aligns to 91:343/357 of 3pwkA
Sites not aligning to the query:
>GFF1874 FitnessBrowser__Marino:GFF1874
MVGSVLMQRMREENDFADIEPVFFTTSQAGKPAPDVGKDDVPPLQDAFDVEILKTMDVIV
TCQGGDYTGAVYQKLRDAGWEGYWIDAASTLRMVDHSVIVLDPVNRNVIDAALEKGVKDY
IGGNCTVSLMMLALGGLLEQDLIEWVSPMTYQAASGSGAQNMRELLNQMGELNKSVKSEL
DDPSSAILEIDRKVTETMRSDGFPTEHFQVPLAGSLIPFIDKQLDNGMSKEEWKAGVETN
KILGRSDNPIPIDGICVRIGAMRSHSQALTIKLKKDLPVSEIESILAKANDWVKVIPNDR
DATIEELTPAKVTGTLSVPVGRIRKLTMGPEYISAFTVGDQLLWGAAEPLRRMLRILQER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory