Comparing GFF1879 FitnessBrowser__WCS417:GFF1879 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
8gxkB Pseudomonas jinjuensis n-acetyltransferase (see paper)
42% identity, 76% coverage: 44:188/192 of query aligns to 43:184/188 of 8gxkB
Sites not aligning to the query:
1yreB Hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
39% identity, 77% coverage: 43:190/192 of query aligns to 42:186/187 of 1yreB
Sites not aligning to the query:
8gxfB Pseudomonas flexibilis gcn5 family acetyltransferase (see paper)
37% identity, 77% coverage: 43:190/192 of query aligns to 42:186/187 of 8gxfB
4r9mA Crystal structure of spermidine n-acetyltransferase from escherichia coli (see paper)
24% identity, 90% coverage: 7:179/192 of query aligns to 3:166/169 of 4r9mA
P0A951 Spermidine N(1)-acetyltransferase; SAT; Spermidine/spermine N(1)-acetyltransferase; SSAT; EC 2.3.1.57 from Escherichia coli (strain K12) (see 4 papers)
26% identity, 56% coverage: 73:179/192 of query aligns to 65:169/186 of P0A951
Sites not aligning to the query:
3wr7A Crystal structure of spermidine acetyltransferase from escherichia coli (see paper)
26% identity, 56% coverage: 73:179/192 of query aligns to 61:165/170 of 3wr7A
Sites not aligning to the query:
6c37A Mycobacterium smegmatis rimj in complex with coa-disulfide
29% identity, 65% coverage: 61:185/192 of query aligns to 77:198/209 of 6c37A
Sites not aligning to the query:
6c32A Mycobacterium smegmatis rimj with accoa
29% identity, 65% coverage: 61:185/192 of query aligns to 77:198/209 of 6c32A
Sites not aligning to the query:
>GFF1879 FitnessBrowser__WCS417:GFF1879
MTLISLTGTTVELLPLQREHKTALLEAAADGELWNLKVTNVPGPDTVDKYIDTALAGRDA
GSMIPFTLVRRDDGQVVGSTRFWKVDRINRKLEIGHTWLALSTQKSAINTEAKLLLLTYA
FEVLDCVRVQFTTDELNEKSRAAILRLGAVQEGIVRHERIMPDGRKRNSVRFSIIDSEWP
QVKANLQAKLQR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory