SitesBLAST
Comparing GFF1892 FitnessBrowser__psRCH2:GFF1892 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WID3 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; Phosphofructokinase B; Phosphohexokinase 2; Tagatose-6-phosphate kinase; EC 2.7.1.11; EC 2.7.1.144 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
46% identity, 98% coverage: 2:307/312 of query aligns to 12:315/339 of P9WID3
- K283 (≠ E275) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3uqdB Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
39% identity, 97% coverage: 1:304/312 of query aligns to 1:303/309 of 3uqdB
- active site: G253 (= G254), A254 (= A255), G255 (= G256), D256 (= D257)
- binding adenosine-5'-diphosphate: K185 (= K186), N187 (≠ S188), S224 (= S225), G226 (= G227), P227 (≠ A228), G229 (= G230), S248 (≠ V249), M258 (= M259), V280 (≠ I281), G283 (= G284), S284 (≠ A285)
- binding adenosine-5'-triphosphate: Y23 (≠ I23), K27 (= K27)
- binding 6-O-phosphono-beta-D-fructofuranose: K27 (= K27), R29 (= R29)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: D14 (= D14), G39 (= G39), N43 (= N43), R90 (= R90), R105 (= R105), S139 (= S140), G253 (= G254)
3uqdA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
39% identity, 97% coverage: 1:304/312 of query aligns to 1:303/309 of 3uqdA
- active site: G253 (= G254), A254 (= A255), G255 (= G256), D256 (= D257)
- binding adenosine-5'-triphosphate: K185 (= K186), S224 (= S225), G226 (= G227), P227 (≠ A228), G229 (= G230), T251 (≠ A252), G255 (= G256), M258 (= M259), V280 (≠ I281), G283 (= G284), S284 (≠ A285), T287 (≠ V288)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D14), G38 (= G38), G39 (= G39), N43 (= N43), R90 (= R90), S139 (= S140), D256 (= D257)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: K27 (= K27), R29 (= R29)
3n1cA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate (see paper)
39% identity, 97% coverage: 1:304/312 of query aligns to 1:303/309 of 3n1cA
- active site: G253 (= G254), A254 (= A255), G255 (= G256), D256 (= D257)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D14), K27 (= K27), R29 (= R29), G39 (= G39), N43 (= N43), R90 (= R90), G138 (= G139), S139 (= S140), D256 (= D257)
P06999 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; 6-phosphofructokinase isozyme II; Phosphohexokinase 2; EC 2.7.1.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 97% coverage: 1:304/312 of query aligns to 1:303/309 of P06999
- K27 (= K27) binding ; binding
- KPN 185:187 (≠ KPS 186:188) binding in other chain
- NQK 187:189 (≠ SLD 188:190) binding in other chain
- E190 (= E191) mutation to Q: Causes a 50-fold decrease in the kcat value and a 15-fold increment in the apparent KM for ATP.
- SLGPQG 224:229 (≠ SLGADG 225:230) binding in other chain
- S248 (≠ V249) binding in other chain
- S250 (= S251) binding
- V252 (= V253) binding
- V280 (≠ I281) binding in other chain
- S284 (≠ A285) binding in other chain
- A286 (≠ T287) binding
- N289 (≠ R290) binding
- G291 (= G292) binding
- R293 (≠ E294) binding
3uqeA Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
38% identity, 97% coverage: 1:304/312 of query aligns to 1:301/307 of 3uqeA
- active site: G253 (= G254), A254 (= A255), G255 (= G256), D256 (= D257)
- binding adenosine-5'-triphosphate: K185 (= K186), N187 (≠ S188), S224 (= S225), G226 (= G227), P227 (≠ A228), G229 (= G230), S248 (≠ V249), A254 (= A255), G255 (= G256), M258 (= M259), V280 (≠ I281), G283 (= G284), S284 (≠ A285), T287 (≠ V288)
- binding pyrophosphate 2-: N187 (≠ S188), K189 (≠ D190)
3cqdA Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli (see paper)
38% identity, 97% coverage: 1:304/312 of query aligns to 1:298/304 of 3cqdA
- active site: G253 (= G254), A254 (= A255), G255 (= G256), D256 (= D257)
- binding adenosine-5'-triphosphate: Y23 (≠ I23), G26 (≠ E26), K27 (= K27), K185 (= K186), N187 (≠ S188), N187 (≠ S188), K189 (≠ D190), S224 (= S225), G226 (= G227), P227 (≠ A228), G229 (= G230), S248 (≠ V249), T251 (≠ A252), A254 (= A255), G255 (= G256), M258 (= M259), V280 (≠ I281), G283 (= G284), S284 (≠ A285), T287 (≠ V288)
2f02A Crystal structure of lacc from enterococcus faecalis in complex with atp
32% identity, 97% coverage: 3:305/312 of query aligns to 2:304/319 of 2f02A
- binding adenosine-5'-triphosphate: N186 (≠ S188), S224 (= S225), G226 (= G227), I243 (≠ T244), I246 (≠ V247), G253 (= G254), S254 (≠ A255), G255 (= G256), T258 (≠ M259), M280 (≠ I281), G283 (= G284), M284 (≠ A285)
2jgvB Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp (see paper)
28% identity, 87% coverage: 3:272/312 of query aligns to 5:273/314 of 2jgvB
Sites not aligning to the query:
2jg1C Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
27% identity, 87% coverage: 3:272/312 of query aligns to 6:274/315 of 2jg1C
- active site: G256 (= G254), S257 (≠ A255), G258 (= G256), D259 (= D257)
- binding phosphoaminophosphonic acid-adenylate ester: S227 (= S225), G229 (= G227), A230 (= A228), G232 (= G230), I246 (≠ T244), I249 (≠ V247), V251 (= V249), V255 (= V253), G256 (= G254), S257 (≠ A255), G258 (= G256), D259 (= D257), T261 (≠ M259)
- binding 6-O-phosphono-beta-D-tagatofuranose: D17 (= D14), G42 (= G39), K43 (≠ G40), R93 (= R90), C95 (≠ S92), L108 (≠ V107), G140 (= G139), S141 (= S140), D259 (= D257)
Sites not aligning to the query:
2jg1A Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
27% identity, 87% coverage: 3:272/312 of query aligns to 9:277/318 of 2jg1A
- active site: G259 (= G254), S260 (≠ A255), G261 (= G256), D262 (= D257)
- binding phosphoaminophosphonic acid-adenylate ester: K46 (≠ G40), N193 (≠ S188), S230 (= S225), G232 (= G227), G235 (= G230), I252 (≠ V247), V254 (= V249), G259 (= G254), S260 (≠ A255), G261 (= G256), D262 (= D257), T264 (≠ M259)
Sites not aligning to the query:
3ie7A The crystal structure of phosphofructokinase (lin2199) from listeria innocua in complex with atp at 1.6a
32% identity, 92% coverage: 3:290/312 of query aligns to 2:285/309 of 3ie7A
- binding adenosine-5'-triphosphate: N188 (≠ S188), S220 (= S225), G222 (= G227), A223 (= A228), G225 (= G230), V242 (= V247), G249 (= G254), A250 (= A255), G251 (= G256), D252 (= D257), S279 (≠ G284), V283 (= V288)
3julA Crystal structure of listeria innocua d-tagatose-6-phosphate kinase bound with substrate
31% identity, 92% coverage: 3:290/312 of query aligns to 2:278/298 of 3julA
2ajrA Crystal structure of possible 1-phosphofructokinase (ec 2.7.1.56) (tm0828) from thermotoga maritima at 2.46 a resolution
24% identity, 96% coverage: 3:303/312 of query aligns to 2:309/320 of 2ajrA
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
33% identity, 33% coverage: 207:310/312 of query aligns to 209:313/313 of Q97U29
Sites not aligning to the query:
- 34:38 binding
- 90 binding
- 106:108 binding
- 164:166 binding
- 166 binding
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
34% identity, 32% coverage: 207:306/312 of query aligns to 208:308/311 of 2varA
- active site: G254 (= G254), A255 (= A255), G256 (= G256), D257 (= D257)
- binding adenosine monophosphate: G227 (= G227), G230 (= G230), M259 (= M259), S284 (≠ G284), I288 (≠ V288)
- binding phosphoaminophosphonic acid-adenylate ester: K225 (≠ S225), G227 (= G227), S228 (≠ A228), G230 (= G230), G254 (= G254), A255 (= A255), G256 (= G256), D257 (= D257), M259 (= M259), I281 (= I281), S284 (≠ G284), I288 (≠ V288)
- binding 3-deoxy-alpha-D-erythro-hex-2-ulofuranosonic acid: G254 (= G254), D257 (= D257)
- binding 2-keto-3-deoxygluconate: T253 (≠ V253), G254 (= G254), D257 (= D257), D293 (≠ G292)
Sites not aligning to the query:
- binding 3-deoxy-alpha-D-erythro-hex-2-ulofuranosonic acid: 10, 33, 34, 89, 105, 107, 136, 165
- binding 2-keto-3-deoxygluconate: 33, 34, 89, 103, 105, 107, 136, 165
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
31% identity, 35% coverage: 184:292/312 of query aligns to 174:281/299 of 1tz3A
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
31% identity, 35% coverage: 184:292/312 of query aligns to 174:281/297 of 1tz6A
- active site: G238 (= G254), A239 (= A255), G240 (= G256), D241 (= D257)
- binding phosphomethylphosphonic acid adenylate ester: K176 (= K186), E181 (= E191), S209 (= S225), G211 (= G227), A212 (= A228), G214 (= G230), A239 (= A255), G240 (= G256), F243 (≠ M259), N270 (≠ I281), G273 (= G284), A274 (= A285)
- binding 5-aminoimidazole ribonucleoside: D241 (= D257)
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 35% coverage: 184:292/312 of query aligns to 185:292/319 of Q8ZKR2
- G213 (≠ C218) binding
- D246 (≠ S251) binding
- T248 (≠ V253) binding
- D252 (= D257) binding
- A287 (≠ T287) binding
- A290 (≠ R290) binding
- G292 (= G292) binding
Sites not aligning to the query:
- 16 binding
- 31 binding
- 101 binding
- 162 binding
- 180 binding
- 181 binding
- 183 binding
P76658 Bifunctional protein HldE; EC 2.7.1.167; EC 2.7.7.70 from Escherichia coli (strain K12) (see 2 papers)
26% identity, 57% coverage: 116:293/312 of query aligns to 135:300/477 of P76658
- K179 (≠ S169) modified: N6-acetyllysine
- N195 (≠ S188) mutation to D: Loss of activity.
- E198 (= E191) mutation to D: Loss of activity.
- D264 (= D257) mutation to E: Loss of activity.; mutation to N: Loss of activity.
Query Sequence
>GFF1892 FitnessBrowser__psRCH2:GFF1892
MPLIATLTLNPAMDLSVSTARVISTEKLRCSLPRHDPGGGGINVARVVKTLGGKAVAVYP
AGGPFGDLLQRSLDELGLVHRPVPIAGDTRESFTVDELASGLQYRFVLPGPTLSAQELQQ
CLDSLAALRPAPAYVVLSGSFPPGADLGFFDELLALARRIGARLVVDLSGEPLRHAARQG
GVYLMKPSLDELGTLMGRTVSAEAEQEQALRSLIRQGCAEVIVLSLGADGALYAYGDQVG
RLRTPEVPVASAVGAGDSMLGAIVLAMADGRSIPEAVCQGIAAGAATVMRPGTELCHRED
VQRLLQLMESAH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory