Comparing GFF1894 FitnessBrowser__Marino:GFF1894 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P05041 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Escherichia coli (strain K12) (see 4 papers)
43% identity, 77% coverage: 103:459/463 of query aligns to 102:453/453 of P05041
Sites not aligning to the query:
1k0eA The crystal structure of aminodeoxychorismate synthase from formate grown crystals (see paper)
42% identity, 77% coverage: 103:459/463 of query aligns to 100:437/437 of 1k0eA
Sites not aligning to the query:
P28820 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Bacillus subtilis (strain 168) (see paper)
38% identity, 79% coverage: 94:458/463 of query aligns to 87:461/470 of P28820
7pi1DDD Aminodeoxychorismate synthase component 1
38% identity, 79% coverage: 94:458/463 of query aligns to 85:454/459 of 7pi1DDD
Sites not aligning to the query:
1k0gA The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
39% identity, 77% coverage: 103:459/463 of query aligns to 102:420/420 of 1k0gA
Sites not aligning to the query:
1k0gB The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
39% identity, 77% coverage: 103:457/463 of query aligns to 102:415/415 of 1k0gB
Sites not aligning to the query:
Q94GF1 Anthranilate synthase alpha subunit 1, chloroplastic; OsASA1; EC 4.1.3.27 from Oryza sativa subsp. japonica (Rice) (see paper)
31% identity, 91% coverage: 38:458/463 of query aligns to 107:568/577 of Q94GF1
P32068 Anthranilate synthase alpha subunit 1, chloroplastic; Anthranilate synthase component 1-1; Anthranilate synthase component I-1; Protein A-METHYL TRYPTOPHAN RESISTANT 1; Protein JASMONATE-INDUCED DEFECTIVE LATERAL ROOT 1; Protein TRYPTOPHAN BIOSYNTHESIS 5; Protein WEAK ETHYLENE INSENSITIVE 2; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 78% coverage: 100:458/463 of query aligns to 186:586/595 of P32068
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
37% identity, 76% coverage: 106:458/463 of query aligns to 308:671/673 of 8hx8A
Sites not aligning to the query:
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
36% identity, 76% coverage: 106:458/463 of query aligns to 266:632/632 of 8hx9A
Sites not aligning to the query:
A0QX93 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 76% coverage: 103:454/463 of query aligns to 140:512/524 of A0QX93
O94582 Probable anthranilate synthase component 1; Anthranilate synthase component I; EC 4.1.3.27 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
38% identity, 57% coverage: 198:459/463 of query aligns to 215:476/489 of O94582
Sites not aligning to the query:
5cwaA Structure of anthranilate synthase component i (trpe) from mycobacterium tuberculosis with inhibitor bound (see paper)
34% identity, 77% coverage: 97:454/463 of query aligns to 113:491/505 of 5cwaA
7bvdA Anthranilate synthase component i (trpe)[mycolicibacterium smegmatis]
34% identity, 76% coverage: 103:454/463 of query aligns to 119:487/499 of 7bvdA
Sites not aligning to the query:
P00898 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
36% identity, 60% coverage: 178:455/463 of query aligns to 227:508/520 of P00898
Sites not aligning to the query:
1i1qA Structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium (see paper)
36% identity, 60% coverage: 178:455/463 of query aligns to 223:504/512 of 1i1qA
Sites not aligning to the query:
1i7sA Anthranilate synthase from serratia marcescens in complex with its end product inhibitor l-tryptophan (see paper)
36% identity, 55% coverage: 202:455/463 of query aligns to 240:499/511 of 1i7sA
Sites not aligning to the query:
1i7qA Anthranilate synthase from s. Marcescens (see paper)
36% identity, 55% coverage: 202:455/463 of query aligns to 246:505/517 of 1i7qA
P00897 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Serratia marcescens (see paper)
35% identity, 55% coverage: 202:455/463 of query aligns to 248:507/519 of P00897
Sites not aligning to the query:
5jy9B An iron-bound structure of the salicylate synthase irp9 (see paper)
32% identity, 46% coverage: 244:457/463 of query aligns to 210:422/424 of 5jy9B
Sites not aligning to the query:
>GFF1894 FitnessBrowser__Marino:GFF1894
MCCLSFLEESGGTLNPANMRELTDEGYHRLLSHACRETDFAYIGSVGNGPARGVFSGFSA
RAIATEVLQHPVPEDFCSDQLAQNMESLVHQFQIEQEPNPECLSGGWIGFLGYELGYVRE
NRLRELCPSLDVPLMSAGFYLWTASHNRKTDQYWLWIHPDCPDGTRDLLDQWLATDEPAT
TGWSMVCGFQPRQTPVAFRTSVERVRQYIEAGDCYQANLSQEFSGRFVGDPWRAFQALSD
ANPTPYSGFIRSGEASIISVSPERFLEIHDRTVTTSPIKGTRPRGRTPETDLVYASELEG
SEKDLAENLMIVDLLRNDLGLNAKPGSVKVDKLFALESYKNVHHLVSHIRAELADGVTPM
KALFDAFPGGSITGAPKIRAMEIIRELEPHWRGPYCGSIFYRGLDGTLDSNIAIRTMLCD
GEGTIRCWGGGGIVADSDPEAEYQETLAKVGSLMRFLEELVID
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory