SitesBLAST
Comparing GFF1903 FitnessBrowser__WCS417:GFF1903 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
42% identity, 99% coverage: 1:263/266 of query aligns to 1:257/261 of P40288
- 11:35 (vs. 11:35, 40% identical) binding
- E96 (≠ Q96) mutation E->A,G,K: Heat stable.
- D108 (= D108) mutation to N: Heat stable.
- V112 (= V112) mutation to A: Heat stable.
- E133 (≠ R133) mutation to K: Heat stable.
- V183 (≠ I190) mutation to I: Heat stable.
- P194 (≠ A201) mutation to Q: Heat stable.
- E210 (≠ L216) mutation to K: Heat stable.
- Y217 (≠ R223) mutation to H: Heat stable.
- Q252 (≠ L258) mutation to L: Heat stable.
- Y253 (= Y259) mutation to C: Heat stable.
Sites not aligning to the query:
- 258 A→G: Heat stable.
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
42% identity, 99% coverage: 1:263/266 of query aligns to 1:257/261 of 1g6kA
- active site: G18 (= G18), S145 (= S152), Y158 (= Y165), K162 (= K169)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S17), G18 (= G18), L19 (≠ I19), R39 (≠ N39), D65 (≠ N65), V66 (= V66), N92 (= N92), A93 (≠ S93), G94 (= G94), M143 (= M150), S145 (= S152), Y158 (= Y165), P188 (= P195), G189 (= G196), I191 (= I198), T193 (= T200)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
39% identity, 99% coverage: 1:263/266 of query aligns to 7:263/267 of 3ay6B
- active site: G24 (= G18), S151 (= S152), Y164 (= Y165), K168 (= K169)
- binding beta-D-glucopyranose: E102 (≠ Q96), S151 (= S152), H153 (= H154), W158 (= W159), Y164 (= Y165), N202 (= N203), K205 (≠ A206)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G14), T23 (≠ S17), G24 (= G18), L25 (≠ I19), Y45 (≠ N39), D71 (≠ N65), V72 (= V66), N98 (= N92), A99 (≠ S93), G100 (= G94), V101 (≠ M95), M149 (= M150), S151 (= S152), Y164 (= Y165), K168 (= K169), P194 (= P195), G195 (= G196), M197 (≠ I198), T199 (= T200), P200 (≠ A201), I201 (= I202), N202 (= N203)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
43% identity, 96% coverage: 3:258/266 of query aligns to 1:247/247 of 4jroC
- active site: G16 (= G18), S142 (= S152), Q152 (≠ H162), Y155 (= Y165), K159 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (= S16), R15 (≠ S17), G16 (= G18), I17 (= I19), N35 (= N37), Y36 (= Y38), N37 (= N39), G38 (≠ S40), S39 (≠ Q41), N63 (= N65), V64 (= V66), N90 (= N92), A91 (≠ S93), I93 (≠ M95), I113 (≠ V115), S142 (= S152), Y155 (= Y165), K159 (= K169), P185 (= P195), I188 (= I198), T190 (= T200)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
41% identity, 96% coverage: 4:259/266 of query aligns to 3:247/247 of P73574
- A14 (= A15) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ A160) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K169) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ A197) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ A211) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
41% identity, 94% coverage: 9:258/266 of query aligns to 3:244/244 of 1edoA
- active site: G12 (= G18), S138 (= S152), Y151 (= Y165), K155 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (= S16), R11 (≠ S17), I13 (= I19), N31 (= N37), Y32 (= Y38), A33 (≠ N39), R34 (≠ S40), S35 (≠ Q41), D59 (≠ N65), V60 (= V66), N86 (= N92), A87 (≠ S93), S138 (= S152), Y151 (= Y165), K155 (= K169), P181 (= P195), G182 (= G196), I184 (= I198), S186 (≠ T200), M188 (≠ I202)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
41% identity, 94% coverage: 7:255/266 of query aligns to 4:249/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (= S16), R14 (≠ S17), G15 (= G18), I16 (= I19), L36 (≠ N39), R37 (≠ S40), N38 (≠ Q41), A61 (= A64), D62 (≠ N65), V63 (= V66), N89 (= N92), A90 (≠ S93), G91 (= G94), T113 (≠ V115), V143 (≠ M150), S145 (= S152), Y159 (= Y165), K163 (= K169), P189 (= P195), G190 (= G196), I192 (= I198), T194 (= T200), I196 (= I202), H197 (≠ N203)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
41% identity, 96% coverage: 3:258/266 of query aligns to 1:239/240 of 4dmmB
- active site: G16 (= G18), S142 (= S152), Q152 (≠ H162), Y155 (= Y165), K159 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (= S16), R15 (≠ S17), G16 (= G18), I17 (= I19), A37 (≠ N39), S38 (= S40), S39 (≠ Q41), A62 (= A64), D63 (≠ N65), V64 (= V66), N90 (= N92), A91 (≠ S93), L113 (≠ V115), I140 (≠ M150), S142 (= S152), Y155 (= Y165), K159 (= K169), P185 (= P195), G186 (= G196), I188 (= I198), T190 (= T200), M192 (≠ I202)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
38% identity, 94% coverage: 10:258/266 of query aligns to 7:246/246 of 3osuA
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
39% identity, 96% coverage: 3:258/266 of query aligns to 4:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G14), R18 (≠ S17), G19 (= G18), I20 (= I19), D39 (≠ S40), R40 (≠ Q41), C63 (≠ A64), I65 (≠ V66), N91 (= N92), G93 (= G94), I94 (≠ M95), V114 (= V115), Y155 (= Y165), K159 (= K169), I188 (= I198), T190 (= T200), T193 (≠ N203)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
38% identity, 94% coverage: 10:258/266 of query aligns to 4:239/239 of 3sj7A
- active site: G12 (= G18), S138 (= S152), Q148 (≠ H162), Y151 (= Y165), K155 (= K169)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (= S16), R11 (≠ S17), I13 (= I19), N31 (= N37), Y32 (= Y38), A33 (≠ N39), G34 (≠ S40), S35 (≠ Q41), A58 (= A64), N59 (= N65), V60 (= V66), N86 (= N92), A87 (≠ S93), T109 (≠ V115), S138 (= S152), Y151 (= Y165), K155 (= K169), P181 (= P195), G182 (= G196)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
38% identity, 95% coverage: 5:258/266 of query aligns to 5:244/244 of 4nbuB
- active site: G18 (= G18), N111 (= N116), S139 (= S152), Q149 (≠ H162), Y152 (= Y165), K156 (= K169)
- binding acetoacetyl-coenzyme a: D93 (= D98), K98 (≠ D103), S139 (= S152), N146 (≠ W159), V147 (≠ A160), Q149 (≠ H162), Y152 (= Y165), F184 (≠ A197), M189 (≠ I202), K200 (= K213)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ S17), G18 (= G18), I19 (= I19), D38 (≠ Y38), F39 (≠ N39), V59 (≠ A64), D60 (≠ N65), V61 (= V66), N87 (= N92), A88 (≠ S93), G89 (= G94), I90 (≠ M95), T137 (≠ M150), S139 (= S152), Y152 (= Y165), K156 (= K169), P182 (= P195), F184 (≠ A197), T185 (≠ I198), T187 (= T200), M189 (≠ I202)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
37% identity, 95% coverage: 5:256/266 of query aligns to 3:251/256 of 7do7A
- active site: G16 (= G18), S146 (= S152), Y159 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), R15 (≠ S17), G16 (= G18), I17 (= I19), S37 (≠ N39), D66 (≠ N65), A67 (≠ V66), N93 (= N92), A94 (≠ S93), G95 (= G94), I96 (≠ M95), V144 (≠ M150), S145 (= S151), S146 (= S152), Y159 (= Y165), K163 (= K169), P189 (= P195), G190 (= G196), I192 (= I198), T194 (= T200), I196 (= I202)
- binding beta-L-rhamnopyranose: F99 (≠ D98), S146 (= S152), S148 (≠ H154), Q156 (≠ H162), Y159 (= Y165), N197 (= N203), D235 (= D240), M236 (≠ A241), R238 (≠ D243)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
37% identity, 95% coverage: 5:256/266 of query aligns to 3:251/256 of 7b81A
- active site: G16 (= G18), S146 (= S152), Y159 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S14 (= S16), R15 (≠ S17), I17 (= I19), D66 (≠ N65), A67 (≠ V66), N93 (= N92), A94 (≠ S93), G95 (= G94), I96 (≠ M95), T116 (≠ V115), V144 (≠ M150), S146 (= S152), Y159 (= Y165), K163 (= K169), P189 (= P195), G190 (= G196), I192 (= I198), T194 (= T200), I196 (= I202)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
36% identity, 97% coverage: 3:259/266 of query aligns to 1:246/248 of Q9KJF1
- M1 (≠ I3) modified: Initiator methionine, Removed
- S15 (= S17) binding
- D36 (≠ N39) binding
- D62 (≠ N65) binding
- I63 (≠ V66) binding
- N89 (= N92) binding
- Y153 (= Y165) binding
- K157 (= K169) binding
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
36% identity, 96% coverage: 5:259/266 of query aligns to 2:245/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), M16 (≠ I19), D35 (≠ N39), I36 (≠ S40), I62 (≠ V66), N88 (= N92), G90 (= G94), I138 (≠ M150), S140 (= S152), Y152 (= Y165), K156 (= K169), I185 (= I198)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
38% identity, 96% coverage: 2:257/266 of query aligns to 11:258/261 of 5u9pB
- active site: G27 (= G18), S152 (= S152), Y165 (= Y165), K169 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G14), R26 (≠ S17), G27 (= G18), I28 (= I19), R48 (≠ N39), D73 (≠ N65), V74 (= V66), N100 (= N92), A101 (≠ S93), I150 (≠ M150), Y165 (= Y165), K169 (= K169), P195 (= P195), F198 (≠ I198), T200 (= T200), L202 (≠ I202), N203 (= N203)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 96% coverage: 3:258/266 of query aligns to 4:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), S17 (= S16), R18 (≠ S17), I20 (= I19), T40 (≠ N39), N62 (= N65), V63 (= V66), N89 (= N92), A90 (≠ S93), I92 (≠ M95), V139 (≠ M150), S141 (= S152), Y154 (= Y165), K158 (= K169), P184 (= P195), G185 (= G196), I187 (= I198), T189 (= T200), M191 (≠ I202)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
36% identity, 96% coverage: 3:258/266 of query aligns to 4:242/243 of 4i08A
- active site: G19 (= G18), N113 (= N116), S141 (= S152), Q151 (≠ H162), Y154 (= Y165), K158 (= K169)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), S17 (= S16), R18 (≠ S17), I20 (= I19), T40 (≠ N39), N62 (= N65), V63 (= V66), N89 (= N92), A90 (≠ S93), G140 (≠ S151), S141 (= S152), Y154 (= Y165), K158 (= K169), P184 (= P195), G185 (= G196), T189 (= T200)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
36% identity, 96% coverage: 3:258/266 of query aligns to 1:243/244 of 6t77A
- active site: G16 (= G18), S138 (= S152), Y151 (= Y165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (= S16), R15 (≠ S17), T37 (≠ N39), L58 (≠ A64), N59 (= N65), V60 (= V66), A87 (≠ S93), G88 (= G94), I89 (≠ M95)
Query Sequence
>GFF1903 FitnessBrowser__WCS417:GFF1903
MRISLEQQVALVTGASSGIGAGAAKALAQAGAAVVLNYNSQAAPAEALAEQINAEGGRAI
AIGANVSKEDDVESLFAQTLDAFGHLDILVANSGMQKDANLVDMSLDDWNAVIGVNLTGQ
FLCARAAVRIFNRQGVREGVSRAAGKIIHMSSVHQLIPWAGHVNYAASKGGVEMLMRTLA
QEVSEQRIRINGIAPGAIRTAINRAATEGAAQKELLKLIPYGRVGDVEDVANAVVWLASD
ASDYVVGSTLFIDGGMSLYPEFRGNG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory