Comparing GFF1905 FitnessBrowser__Phaeo:GFF1905 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cekA Succinyl-coa reductase from clostridium kluyveri (sucd) with NADPH (see paper)
33% identity, 95% coverage: 15:461/469 of query aligns to 5:449/449 of 8cekA
8cejC Succinyl-coa reductase from clostridium kluyveri (sucd) with mesaconyl-c1-coa (see paper)
33% identity, 95% coverage: 15:461/469 of query aligns to 5:449/449 of 8cejC
8cejA Succinyl-coa reductase from clostridium kluyveri (sucd) with mesaconyl-c1-coa (see paper)
33% identity, 95% coverage: 15:461/469 of query aligns to 5:449/449 of 8cejA
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
33% identity, 96% coverage: 1:451/469 of query aligns to 2:450/455 of 5j7iC
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
33% identity, 96% coverage: 1:451/469 of query aligns to 3:451/456 of 5j7iB
P0A9Q7 Bifunctional aldehyde-alcohol dehydrogenase AdhE; Alcohol dehydrogenase E; EC 1.2.1.10; EC 1.1.1.1 from Escherichia coli (strain K12) (see 8 papers)
34% identity, 92% coverage: 16:447/469 of query aligns to 12:446/891 of P0A9Q7
Sites not aligning to the query:
P0A9Q8 Bifunctional aldehyde-alcohol dehydrogenase AdhE; Alcohol dehydrogenase E; EC 1.2.1.10; EC 1.1.1.1 from Escherichia coli O157:H7 (see paper)
34% identity, 92% coverage: 16:447/469 of query aligns to 12:446/891 of P0A9Q8
Sites not aligning to the query:
7bvpA Adhe spirosome in extended conformation (see paper)
34% identity, 92% coverage: 16:447/469 of query aligns to 12:446/869 of 7bvpA
Sites not aligning to the query:
6tqmA Escherichia coli adhe structure in its compact conformation (see paper)
34% identity, 92% coverage: 16:447/469 of query aligns to 12:446/869 of 6tqmA
Sites not aligning to the query:
5jfmB Crystal structure of rhodopseudomonas palustris propionaldehyde dehydrogenase with bound propionyl-coa (see paper)
29% identity, 71% coverage: 31:364/469 of query aligns to 40:371/452 of 5jfmB
5jflA Crystal structure of rhodopseudomonas palustris propionaldehyde dehydrogenase with bound NAD+ (see paper)
29% identity, 71% coverage: 31:364/469 of query aligns to 28:359/440 of 5jflA
Sites not aligning to the query:
5jfmA Crystal structure of rhodopseudomonas palustris propionaldehyde dehydrogenase with bound propionyl-coa (see paper)
29% identity, 71% coverage: 31:364/469 of query aligns to 27:358/439 of 5jfmA
6gvsA Engineered glycolyl-coa reductase comprising 8 mutations with bound NADP+ (see paper)
29% identity, 70% coverage: 31:359/469 of query aligns to 29:355/441 of 6gvsA
Sites not aligning to the query:
4c3sA Structure of a propionaldehyde dehydrogenase from the clostridium phytofermentans fucose utilisation bacterial microcompartment (see paper)
26% identity, 75% coverage: 55:405/469 of query aligns to 48:393/435 of 4c3sA
Sites not aligning to the query:
5dbvA Structure of a c269a mutant of propionaldehyde dehydrogenase from the clostridium phytofermentans fucose utilisation bacterial microcompartment (see paper)
27% identity, 75% coverage: 55:405/469 of query aligns to 47:389/431 of 5dbvA
Q9XDN1 Propanal dehydrogenase (CoA-propanoylating); Coenzyme-A-acylating propionaldehyde dehydrogenase; Propanediol utilization protein PduP; EC 1.2.1.87 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
25% identity, 77% coverage: 55:414/469 of query aligns to 77:430/464 of Q9XDN1
Sites not aligning to the query:
1wndA Escherichia coli ydcw gene product is a medium-chain aldehyde dehydrogenase as determined by kinetics and crystal structure (see paper)
28% identity, 35% coverage: 108:271/469 of query aligns to 138:302/474 of 1wndA
Sites not aligning to the query:
1wnbB Escherichia coli ydcw gene product is a medium-chain aldehyde dehydrogenase (complexed with nadh and betaine aldehyde) (see paper)
28% identity, 35% coverage: 108:271/469 of query aligns to 138:302/474 of 1wnbB
Sites not aligning to the query:
1wnbA Escherichia coli ydcw gene product is a medium-chain aldehyde dehydrogenase (complexed with nadh and betaine aldehyde) (see paper)
28% identity, 35% coverage: 108:271/469 of query aligns to 138:302/474 of 1wnbA
Sites not aligning to the query:
P77674 Gamma-aminobutyraldehyde dehydrogenase; ABALDH; 1-pyrroline dehydrogenase; 4-aminobutanal dehydrogenase; 5-aminopentanal dehydrogenase; EC 1.2.1.19; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
28% identity, 35% coverage: 108:271/469 of query aligns to 138:302/474 of P77674
>GFF1905 FitnessBrowser__Phaeo:GFF1905
MAKELTEQDRALAADMIARARAAMAEIEDWSQADLDRLSQAIAWYAGNEATFTRLAEKGV
DESGIGDRAGRPAKRFKIQMVLRDVLRTPSTGVVEVDEEKGLVKYAKPAGVIASLIPMTN
PAMTPPVTGVSSANARNAVIFSPHPRTAGTTFDMTEMMRKACVAVGAPADLFQAVRHPSI
PLTQHLMEECDLTLATGGKPMVKAAYSSGRPAYGVGAGNSSIVIDETADIDIAAQNTRIS
KTSDFGSGCSADGNIIIQRSVYDDMVKALEAEGGYLCSPAEKTLLEKAMWDEKGNRTFTT
IACKPQQTADVAGFSIPDDRKFLMVENQSQIGPEHKFSKEKLTTVMALYHFETFDDALET
VRQIYATGGVGHSCGIYSHNDDNIDALARVAPVSRMMVRQPQSKANAGSWTNGMPMTSSL
GCGIWGGNITNENVTMKHMMNYTWVARPIAEDRPSEEDLFGEFYGQEIA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory