SitesBLAST
Comparing GFF1906 FitnessBrowser__Phaeo:GFF1906 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 15:573/585 of 5k2oA
- active site: Y33 (≠ L34), G35 (= G36), G36 (≠ H37), A37 (≠ T38), S38 (≠ N39), E59 (= E59), T82 (≠ H82), F121 (≠ H121), Q122 (= Q122), E123 (= E123), K171 (≠ M177), M266 (≠ F273), V293 (≠ Y308), V400 (= V418), G426 (≠ A444), M428 (= M446), D453 (= D471), N480 (= N498), H482 (≠ A500), L483 (≠ F501), M485 (≠ T503), V486 (≠ I504), W489 (≠ L507), H558 (vs. gap)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (≠ F273), R292 (≠ A299), W489 (≠ L507), S568 (≠ T580)
- binding flavin-adenine dinucleotide: R161 (≠ Q167), G222 (= G227), G223 (= G228), G224 (= G229), T246 (≠ S253), L247 (= L254), M248 (= M255), L264 (≠ T271), G286 (= G293), R288 (= R295), D290 (≠ K297), V293 (≠ Y308), D310 (= D325), I311 (= I326), D329 (= D344), V330 (≠ A345), Q404 (≠ K422), M405 (≠ N423), G423 (= G441)
- binding magnesium ion: D453 (= D471), N480 (= N498), H482 (≠ A500)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V418), G401 (= G419), Q402 (≠ W420), H403 (≠ N421), M428 (= M446), D453 (= D471), G454 (= G472), S455 (≠ G473), N480 (= N498), H482 (≠ A500), L483 (≠ F501), G484 (= G502), M485 (≠ T503), V486 (≠ I504)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 15:573/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V418), G401 (= G419), Q402 (≠ W420), H403 (≠ N421), G426 (≠ A444), M428 (= M446), G452 (= G470), D453 (= D471), G454 (= G472), S455 (≠ G473), M458 (≠ Q476), N480 (= N498), H482 (≠ A500), L483 (≠ F501), G484 (= G502), M485 (≠ T503), V486 (≠ I504)
- binding flavin-adenine dinucleotide: R161 (≠ Q167), G222 (= G227), G223 (= G228), G224 (= G229), T246 (≠ S253), L247 (= L254), M248 (= M255), L264 (≠ T271), M266 (≠ F273), H267 (≠ W274), G286 (= G293), V287 (≠ T294), R288 (= R295), D290 (≠ K297), R292 (≠ A299), V293 (≠ Y308), D310 (= D325), I311 (= I326), D329 (= D344), V330 (≠ A345), M405 (≠ N423), G423 (= G441)
- binding magnesium ion: F370 (= F393), D453 (= D471), M458 (≠ Q476), Q461 (≠ S479), N480 (= N498), H482 (≠ A500), K533 (≠ A550)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ F273), R292 (≠ A299), M485 (≠ T503), W489 (≠ L507), S568 (≠ T580)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 15:573/582 of 5wj1A
- active site: Y33 (≠ L34), G35 (= G36), G36 (≠ H37), A37 (≠ T38), S38 (≠ N39), E59 (= E59), T82 (≠ H82), F121 (≠ H121), Q122 (= Q122), E123 (= E123), K171 (≠ M177), M266 (≠ F273), V293 (≠ Y308), V400 (= V418), G426 (≠ A444), M428 (= M446), D453 (= D471), N480 (= N498), H482 (≠ A500), L483 (≠ F501), M485 (≠ T503), V486 (≠ I504), W489 (≠ L507), H558 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (≠ Q167), G222 (= G227), G223 (= G228), G224 (= G229), T246 (≠ S253), L247 (= L254), M248 (= M255), M263 (= M270), L264 (≠ T271), G286 (= G293), R288 (= R295), V293 (≠ Y308), D310 (= D325), I311 (= I326), D329 (= D344), V330 (≠ A345), M405 (≠ N423), G423 (= G441), G424 (= G442)
- binding magnesium ion: D453 (= D471), N480 (= N498), H482 (≠ A500)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ F273), D291 (≠ E298), R292 (≠ A299), M485 (≠ T503), W489 (≠ L507), S568 (≠ T580)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V418), G401 (= G419), Q402 (≠ W420), H403 (≠ N421), M428 (= M446), D453 (= D471), G454 (= G472), S455 (≠ G473), M458 (≠ Q476), N480 (= N498), H482 (≠ A500), L483 (≠ F501), G484 (= G502), M485 (≠ T503), V486 (≠ I504)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 15:573/582 of 5k6tA
- active site: Y33 (≠ L34), G35 (= G36), G36 (≠ H37), A37 (≠ T38), S38 (≠ N39), E59 (= E59), T82 (≠ H82), F121 (≠ H121), Q122 (= Q122), E123 (= E123), K171 (≠ M177), M266 (≠ F273), V293 (≠ Y308), V400 (= V418), G426 (≠ A444), M428 (= M446), D453 (= D471), N480 (= N498), H482 (≠ A500), L483 (≠ F501), M485 (≠ T503), V486 (≠ I504), W489 (≠ L507), H558 (vs. gap)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (≠ W274), R292 (≠ A299), M485 (≠ T503), W489 (≠ L507), S568 (≠ T580)
- binding flavin-adenine dinucleotide: R161 (≠ Q167), G222 (= G227), G223 (= G228), G224 (= G229), T246 (≠ S253), L247 (= L254), M248 (= M255), L264 (≠ T271), G286 (= G293), R288 (= R295), D290 (≠ K297), R292 (≠ A299), V293 (≠ Y308), D310 (= D325), I311 (= I326), D329 (= D344), V330 (≠ A345), Q404 (≠ K422), M405 (≠ N423), G423 (= G441)
- binding magnesium ion: D453 (= D471), N480 (= N498), H482 (≠ A500)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V418), G401 (= G419), Q402 (≠ W420), H403 (≠ N421), G426 (≠ A444), M428 (= M446), G452 (= G470), G454 (= G472), S455 (≠ G473), N480 (= N498), H482 (≠ A500), L483 (≠ F501), G484 (= G502)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 15:573/582 of 5k6rA
- active site: Y33 (≠ L34), G35 (= G36), G36 (≠ H37), A37 (≠ T38), S38 (≠ N39), E59 (= E59), T82 (≠ H82), F121 (≠ H121), Q122 (= Q122), E123 (= E123), K171 (≠ M177), M266 (≠ F273), V293 (≠ Y308), V400 (= V418), G426 (≠ A444), M428 (= M446), D453 (= D471), N480 (= N498), H482 (≠ A500), L483 (≠ F501), M485 (≠ T503), V486 (≠ I504), W489 (≠ L507), H558 (vs. gap)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (≠ A299), W489 (≠ L507), S568 (≠ T580)
- binding flavin-adenine dinucleotide: R161 (≠ Q167), G222 (= G227), G223 (= G228), G224 (= G229), T246 (≠ S253), L247 (= L254), M248 (= M255), L264 (≠ T271), M266 (≠ F273), G286 (= G293), R288 (= R295), R292 (≠ A299), V293 (≠ Y308), D310 (= D325), I311 (= I326), G328 (≠ A343), D329 (= D344), V330 (≠ A345), M405 (≠ N423), G423 (= G441)
- binding magnesium ion: D453 (= D471), N480 (= N498), H482 (≠ A500)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V418), G401 (= G419), Q402 (≠ W420), H403 (≠ N421), G426 (≠ A444), M428 (= M446), D453 (= D471), G454 (= G472), S455 (≠ G473), M458 (≠ Q476), N480 (= N498), H482 (≠ A500), L483 (≠ F501), G484 (= G502), M485 (≠ T503), V486 (≠ I504)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 15:573/582 of 1z8nA
- active site: Y33 (≠ L34), G35 (= G36), G36 (≠ H37), A37 (≠ T38), S38 (≠ N39), E59 (= E59), T82 (≠ H82), F121 (≠ H121), Q122 (= Q122), E123 (= E123), K171 (≠ M177), M266 (≠ F273), V293 (≠ Y308), V400 (= V418), G426 (≠ A444), M428 (= M446), D453 (= D471), N480 (= N498), H482 (≠ A500), L483 (≠ F501), M485 (≠ T503), V486 (≠ I504), W489 (≠ L507), H558 (vs. gap)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K141), R161 (≠ Q167), Y191 (≠ N195), R194 (≠ T198), D291 (≠ E298), R292 (≠ A299), D312 (≠ E327), W489 (≠ L507), G569 (≠ T581)
- binding flavin-adenine dinucleotide: R161 (≠ Q167), G222 (= G227), G224 (= G229), T246 (≠ S253), L247 (= L254), M248 (= M255), L264 (≠ T271), G265 (= G272), M266 (≠ F273), H267 (≠ W274), G286 (= G293), V287 (≠ T294), R288 (= R295), D290 (≠ K297), R292 (≠ A299), V293 (≠ Y308), D310 (= D325), I311 (= I326), D329 (= D344), V330 (≠ A345), M405 (≠ N423), G423 (= G441), G424 (= G442)
- binding magnesium ion: D453 (= D471), N480 (= N498)
- binding thiamine diphosphate: V400 (= V418), G401 (= G419), Q402 (≠ W420), H403 (≠ N421), G426 (≠ A444), M428 (= M446), G452 (= G470), G454 (= G472), S455 (≠ G473), N480 (= N498), H482 (≠ A500), L483 (≠ F501), G484 (= G502), M485 (≠ T503), V486 (≠ I504)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 15:573/582 of 1yi1A
- active site: Y33 (≠ L34), G35 (= G36), G36 (≠ H37), A37 (≠ T38), S38 (≠ N39), E59 (= E59), T82 (≠ H82), F121 (≠ H121), Q122 (= Q122), E123 (= E123), K171 (≠ M177), M266 (≠ F273), V293 (≠ Y308), V400 (= V418), G426 (≠ A444), M428 (= M446), D453 (= D471), N480 (= N498), H482 (≠ A500), L483 (≠ F501), M485 (≠ T503), V486 (≠ I504), W489 (≠ L507), H558 (vs. gap)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (≠ E298), R292 (≠ A299), W489 (≠ L507), S568 (≠ T580)
- binding flavin-adenine dinucleotide: R161 (≠ Q167), G223 (= G228), G224 (= G229), T246 (≠ S253), L247 (= L254), M248 (= M255), M263 (= M270), L264 (≠ T271), G265 (= G272), M266 (≠ F273), H267 (≠ W274), G286 (= G293), V287 (≠ T294), R288 (= R295), D290 (≠ K297), V293 (≠ Y308), D310 (= D325), I311 (= I326), D329 (= D344), V330 (≠ A345), M405 (≠ N423), G423 (= G441), G424 (= G442)
- binding magnesium ion: D453 (= D471), N480 (= N498), H482 (≠ A500)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 15:573/582 of 1yi0A
- active site: Y33 (≠ L34), G35 (= G36), G36 (≠ H37), A37 (≠ T38), S38 (≠ N39), E59 (= E59), T82 (≠ H82), F121 (≠ H121), Q122 (= Q122), E123 (= E123), K171 (≠ M177), M266 (≠ F273), V293 (≠ Y308), V400 (= V418), G426 (≠ A444), M428 (= M446), D453 (= D471), N480 (= N498), H482 (≠ A500), L483 (≠ F501), M485 (≠ T503), V486 (≠ I504), W489 (≠ L507), H558 (vs. gap)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (≠ E298), R292 (≠ A299), W489 (≠ L507), S568 (≠ T580)
- binding flavin-adenine dinucleotide: R161 (≠ Q167), G222 (= G227), G223 (= G228), G224 (= G229), T246 (≠ S253), L247 (= L254), M248 (= M255), L264 (≠ T271), G265 (= G272), M266 (≠ F273), H267 (≠ W274), G286 (= G293), V287 (≠ T294), R288 (= R295), D290 (≠ K297), R292 (≠ A299), V293 (≠ Y308), D310 (= D325), I311 (= I326), G328 (≠ A343), D329 (= D344), V330 (≠ A345), M405 (≠ N423), G423 (= G441), G424 (= G442)
- binding magnesium ion: D453 (= D471), N480 (= N498), H482 (≠ A500)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 15:573/582 of 1yhzA
- active site: Y33 (≠ L34), G35 (= G36), G36 (≠ H37), A37 (≠ T38), S38 (≠ N39), E59 (= E59), T82 (≠ H82), F121 (≠ H121), Q122 (= Q122), E123 (= E123), K171 (≠ M177), M266 (≠ F273), V293 (≠ Y308), V400 (= V418), G426 (≠ A444), M428 (= M446), D453 (= D471), N480 (= N498), H482 (≠ A500), L483 (≠ F501), M485 (≠ T503), V486 (≠ I504), W489 (≠ L507), H558 (vs. gap)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (≠ E298), R292 (≠ A299), M485 (≠ T503), W489 (≠ L507), S568 (≠ T580)
- binding flavin-adenine dinucleotide: R161 (≠ Q167), G223 (= G228), G224 (= G229), T246 (≠ S253), L247 (= L254), M248 (= M255), L264 (≠ T271), M266 (≠ F273), H267 (≠ W274), G286 (= G293), V287 (≠ T294), R288 (= R295), D290 (≠ K297), V293 (≠ Y308), D310 (= D325), I311 (= I326), D329 (= D344), V330 (≠ A345), Q404 (≠ K422), M405 (≠ N423), G423 (= G441), G424 (= G442)
- binding magnesium ion: D453 (= D471), N480 (= N498), H482 (≠ A500)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 15:573/582 of 1yhyA
- active site: Y33 (≠ L34), G35 (= G36), G36 (≠ H37), A37 (≠ T38), S38 (≠ N39), E59 (= E59), T82 (≠ H82), F121 (≠ H121), Q122 (= Q122), E123 (= E123), K171 (≠ M177), M266 (≠ F273), V293 (≠ Y308), V400 (= V418), G426 (≠ A444), M428 (= M446), D453 (= D471), N480 (= N498), H482 (≠ A500), L483 (≠ F501), M485 (≠ T503), V486 (≠ I504), W489 (≠ L507), H558 (vs. gap)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (≠ E298), R292 (≠ A299), V486 (≠ I504), W489 (≠ L507), S568 (≠ T580)
- binding flavin-adenine dinucleotide: R161 (≠ Q167), G222 (= G227), G223 (= G228), G224 (= G229), T246 (≠ S253), L247 (= L254), M248 (= M255), L264 (≠ T271), G265 (= G272), M266 (≠ F273), H267 (≠ W274), G286 (= G293), V287 (≠ T294), R288 (= R295), D290 (≠ K297), V293 (≠ Y308), D310 (= D325), I311 (= I326), D329 (= D344), V330 (≠ A345), Q404 (≠ K422), M405 (≠ N423), G423 (= G441), G424 (= G442)
- binding magnesium ion: D453 (= D471), N480 (= N498), H482 (≠ A500)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 15:573/582 of 1ybhA
- active site: Y33 (≠ L34), G35 (= G36), G36 (≠ H37), A37 (≠ T38), S38 (≠ N39), E59 (= E59), T82 (≠ H82), F121 (≠ H121), Q122 (= Q122), E123 (= E123), K171 (≠ M177), M266 (≠ F273), V293 (≠ Y308), V400 (= V418), G426 (≠ A444), M428 (= M446), D453 (= D471), N480 (= N498), H482 (≠ A500), L483 (≠ F501), M485 (≠ T503), V486 (≠ I504), W489 (≠ L507), H558 (vs. gap)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (≠ F273), D291 (≠ E298), R292 (≠ A299), M485 (≠ T503), W489 (≠ L507), S568 (≠ T580)
- binding flavin-adenine dinucleotide: R161 (≠ Q167), G223 (= G228), G224 (= G229), T246 (≠ S253), L247 (= L254), M248 (= M255), L264 (≠ T271), M266 (≠ F273), H267 (≠ W274), G286 (= G293), V287 (≠ T294), R288 (= R295), D290 (≠ K297), V293 (≠ Y308), D310 (= D325), I311 (= I326), D329 (= D344), V330 (≠ A345), Q404 (≠ K422), M405 (≠ N423), G423 (= G441), G424 (= G442)
- binding magnesium ion: D453 (= D471), N480 (= N498), H482 (≠ A500)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
32% identity, 95% coverage: 16:585/601 of query aligns to 100:658/670 of P17597
- A122 (≠ T38) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ I40) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E59) binding
- S186 (≠ C101) binding
- P197 (= P112) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ H114) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q122) binding
- K220 (= K141) binding
- R246 (≠ Q167) binding ; binding
- K256 (≠ M177) binding
- G308 (= G228) binding
- TL 331:332 (≠ SL 253:254) binding
- C340 (≠ D262) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ TGFW 271:274) binding
- GVRFD 371:375 (≠ GTRFK 293:297) binding
- DR 376:377 (≠ EA 298:299) binding
- DI 395:396 (= DI 325:326) binding
- DV 414:415 (≠ DA 344:345) binding
- QH 487:488 (≠ WN 420:421) binding
- GG 508:509 (= GG 441:442) binding
- GAM 511:513 (≠ ATM 444:446) binding
- D538 (= D471) binding
- DGS 538:540 (≠ DGG 471:473) binding
- N565 (= N498) binding
- NQHLGM 565:570 (≠ NNAFGT 498:503) binding
- H567 (≠ A500) binding
- W574 (≠ L507) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ T580) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 15:573/583 of 5k3sA
- active site: Y33 (≠ L34), G35 (= G36), G36 (≠ H37), A37 (≠ T38), S38 (≠ N39), E59 (= E59), T82 (≠ H82), F121 (≠ H121), Q122 (= Q122), E123 (= E123), K171 (≠ M177), M266 (≠ F273), V293 (≠ Y308), V400 (= V418), G426 (≠ A444), M428 (= M446), D453 (= D471), N480 (= N498), H482 (≠ A500), L483 (≠ F501), M485 (≠ T503), V486 (≠ I504), W489 (≠ L507), H558 (vs. gap)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (≠ A299), M485 (≠ T503), W489 (≠ L507), G569 (≠ T581)
- binding flavin-adenine dinucleotide: R161 (≠ Q167), G222 (= G227), G223 (= G228), G224 (= G229), T246 (≠ S253), L247 (= L254), M248 (= M255), L264 (≠ T271), M266 (≠ F273), G286 (= G293), R288 (= R295), D290 (≠ K297), V293 (≠ Y308), D310 (= D325), I311 (= I326), D329 (= D344), V330 (≠ A345), M405 (≠ N423), G423 (= G441)
- binding magnesium ion: D453 (= D471), N480 (= N498), H482 (≠ A500)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V418), G401 (= G419), Q402 (≠ W420), H403 (≠ N421), G426 (≠ A444), M428 (= M446), D453 (= D471), G454 (= G472), S455 (≠ G473), N480 (= N498), H482 (≠ A500), L483 (≠ F501), G484 (= G502), M485 (≠ T503), V486 (≠ I504)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 14:572/582 of 3ea4A
- active site: Y32 (≠ L34), G34 (= G36), G35 (≠ H37), A36 (≠ T38), S37 (≠ N39), E58 (= E59), T81 (≠ H82), F120 (≠ H121), Q121 (= Q122), E122 (= E123), K170 (≠ M177), M265 (≠ F273), V292 (≠ Y308), V399 (= V418), G425 (≠ A444), M427 (= M446), D452 (= D471), N479 (= N498), H481 (≠ A500), L482 (≠ F501), M484 (≠ T503), V485 (≠ I504), W488 (≠ L507), H557 (vs. gap)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (≠ E298), R291 (≠ A299), W488 (≠ L507), S567 (≠ T580)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (≠ Q167), G221 (= G227), G222 (= G228), G223 (= G229), T245 (≠ S253), L246 (= L254), M247 (= M255), L263 (≠ T271), G264 (= G272), M265 (≠ F273), H266 (≠ W274), G285 (= G293), R287 (= R295), D289 (≠ K297), R291 (≠ A299), D309 (= D325), I310 (= I326), G327 (≠ A343), D328 (= D344), V329 (≠ A345), M404 (≠ N423), G422 (= G441)
- binding magnesium ion: D452 (= D471), N479 (= N498), H481 (≠ A500)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V418), G400 (= G419), Q401 (≠ W420), H402 (≠ N421), M427 (= M446), G451 (= G470), D452 (= D471), G453 (= G472), S454 (≠ G473), N479 (= N498), H481 (≠ A500), L482 (≠ F501), G483 (= G502), M484 (≠ T503), V485 (≠ I504)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 14:572/582 of 3e9yA
- active site: Y32 (≠ L34), G34 (= G36), G35 (≠ H37), A36 (≠ T38), S37 (≠ N39), E58 (= E59), T81 (≠ H82), F120 (≠ H121), Q121 (= Q122), E122 (= E123), K170 (≠ M177), M265 (≠ F273), V292 (≠ Y308), V399 (= V418), G425 (≠ A444), M427 (= M446), D452 (= D471), N479 (= N498), H481 (≠ A500), L482 (≠ F501), M484 (≠ T503), V485 (≠ I504), W488 (≠ L507), H557 (vs. gap)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (≠ E298), R291 (≠ A299), W488 (≠ L507), S567 (≠ T580)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (≠ Q167), G221 (= G227), G222 (= G228), G223 (= G229), T245 (≠ S253), L246 (= L254), M247 (= M255), L263 (≠ T271), G285 (= G293), R287 (= R295), D289 (≠ K297), R291 (≠ A299), D309 (= D325), I310 (= I326), G327 (≠ A343), D328 (= D344), V329 (≠ A345), M404 (≠ N423), G422 (= G441)
- binding magnesium ion: D452 (= D471), N479 (= N498), H481 (≠ A500)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V418), G400 (= G419), Q401 (≠ W420), H402 (≠ N421), M427 (= M446), G451 (= G470), G453 (= G472), S454 (≠ G473), N479 (= N498), H481 (≠ A500), L482 (≠ F501), G483 (= G502), M484 (≠ T503), V485 (≠ I504)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
32% identity, 95% coverage: 16:585/601 of query aligns to 15:573/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (≠ F273), R292 (≠ A299), W489 (≠ L507), S568 (≠ T580)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V418), G401 (= G419), Q402 (≠ W420), H403 (≠ N421), G426 (≠ A444), M428 (= M446), G452 (= G470), D453 (= D471), G454 (= G472), S455 (≠ G473), L483 (≠ F501), G484 (= G502), M485 (≠ T503), V486 (≠ I504)
- binding flavin-adenine dinucleotide: R161 (≠ Q167), G222 (= G227), G223 (= G228), G224 (= G229), T246 (≠ S253), L247 (= L254), M248 (= M255), M263 (= M270), L264 (≠ T271), M266 (≠ F273), H267 (≠ W274), G286 (= G293), R288 (= R295), V293 (≠ Y308), D310 (= D325), I311 (= I326), D329 (= D344), V330 (≠ A345), M405 (≠ N423), G423 (= G441)
- binding magnesium ion: A37 (≠ T38), T82 (≠ H82), S83 (≠ L83), Q122 (= Q122), Y381 (≠ T404), D453 (= D471), M458 (≠ Q476), Q461 (≠ S479), N480 (= N498), H482 (≠ A500), K533 (≠ A550)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
32% identity, 92% coverage: 19:571/601 of query aligns to 97:633/664 of P09114
- P191 (= P112) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ L507) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
31% identity, 92% coverage: 19:571/601 of query aligns to 100:636/667 of P09342
- C161 (≠ V79) modified: Disulfide link with 307
- P194 (= P112) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ I230) modified: Disulfide link with 161
6lpiB Crystal structure of ahas holo-enzyme (see paper)
30% identity, 93% coverage: 14:571/601 of query aligns to 7:517/539 of 6lpiB
- active site: I27 (≠ L34), G29 (= G36), G30 (≠ H37), S31 (≠ T38), I32 (≠ N39), E53 (= E59), C76 (≠ H82), F115 (≠ H121), Q116 (= Q122), E117 (= E123), K165 (≠ M177), M256 (≠ F273), A283 (vs. gap), V375 (= V418), G401 (≠ A444), M403 (= M446), D428 (= D471), N455 (= N498), A457 (= A500), L458 (≠ F501), L460 (≠ T503), V461 (≠ I504), Q464 (≠ L507)
- binding flavin-adenine dinucleotide: R155 (≠ Q167), G212 (= G227), G213 (= G228), G214 (= G229), T236 (≠ S253), L237 (= L254), M238 (= M255), L254 (≠ T271), M256 (≠ F273), H257 (≠ W274), G276 (= G293), A277 (≠ T294), R278 (= R295), D280 (≠ K297), R282 (vs. gap), A283 (vs. gap), D300 (= D325), I301 (= I326), D319 (= D344), V320 (≠ A345), M380 (≠ N423), G398 (= G441)
- binding magnesium ion: D428 (= D471), N455 (= N498)
- binding thiamine diphosphate: E53 (= E59), C76 (≠ H82), P79 (= P85), G376 (= G419), Q377 (≠ W420), H378 (≠ N421), G401 (≠ A444), M403 (= M446), G427 (= G470), D428 (= D471), G429 (= G472), S430 (≠ G473), M433 (≠ Q476), N455 (= N498), A457 (= A500), L458 (≠ F501), G459 (= G502), L460 (≠ T503), V461 (≠ I504)
6vz8D Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
31% identity, 93% coverage: 16:571/601 of query aligns to 14:527/531 of 6vz8D
- active site: Y32 (≠ L34), G34 (= G36), G35 (≠ H37), A36 (≠ T38), S37 (≠ N39), E58 (= E59), T81 (≠ H82), F120 (≠ H121), Q121 (= Q122), E122 (= E123), K170 (≠ M177), M256 (≠ F273), V283 (≠ D318), V376 (= V418), G402 (≠ A444), M404 (= M446), D429 (= D471), N456 (= N498), H458 (≠ A500), L459 (≠ F501), M461 (≠ T503), V462 (≠ I504), W465 (≠ L507)
- binding flavin-adenine dinucleotide: G214 (= G227), G215 (= G228), G216 (= G229), T236 (≠ S253), L237 (= L254), L254 (≠ T271), H257 (≠ W274), R278 (= R295), R282 (≠ N317), V283 (≠ D318), I291 (= I326), G399 (= G441)
- binding magnesium ion: H458 (≠ A500), L459 (≠ F501), G460 (= G502)
- binding thiamine diphosphate: E58 (= E59), P84 (= P85), V376 (= V418), G377 (= G419), Q378 (≠ W420), H379 (≠ N421), G402 (≠ A444), M404 (= M446), G428 (= G470), D429 (= D471), G430 (= G472), S431 (≠ G473), L459 (≠ F501), G460 (= G502), M461 (≠ T503), V462 (≠ I504)
Query Sequence
>GFF1906 FitnessBrowser__Phaeo:GFF1906
MLDSKTGKKVDGKTVAEHIVDFLGRRNVEHVFGLCGHTNIAVLAALADSPIDFITVRHEQ
IASHAADAYARVTGRASVVLSHLSPGLTNCATGVANAALDCVPMVVIAGDIPTHYYGKHP
HQEVNLHADAAQWEIYRPFVKRAWRVDRADLMAEILEKAFHLAESGQPGPVLVNVPMDIF
SEVISSDTFDRIASNTKTLVKPSMDDETARRIVSGLAAAKDPVAYIGGGILLAQASAEIE
EFATHMGLPIAHSLMGKGAVRDDHPLVMGMTGFWGTELVNQTCLNADVVFAVGTRFKEAD
CSSWYPGYTFNIGAKGNDTKVIHIDIEPQEIGRNYPTEIGVVADAKAALRVLTRVAKDMY
PDGFNRTEKKAEIAAFREDFKASNVEMQTSAAFPMMPERILADTRIALPDDAIITTDVGW
NKNGVGQQFDILTPGSILTPGGFATMGFGPPAAIGAKLAAPERVVLSLVGDGGFGQNPSM
LATAVELNLGIIWLVMNNNAFGTIAGLQKAHYGLTYGTTFPGSAAAPTNGPGYAEIARAY
GAEGIRISSADELLPALQAAIASGKPTVLDVPMINNPTPTTGHWNILDIYSPDKDVSHVS
T
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory