Comparing GFF1917 FitnessBrowser__Phaeo:GFF1917 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
24% identity, 96% coverage: 6:286/294 of query aligns to 4:277/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
29% identity, 80% coverage: 7:241/294 of query aligns to 27:261/313 of P94529
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
24% identity, 56% coverage: 86:251/294 of query aligns to 283:449/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
24% identity, 56% coverage: 86:251/294 of query aligns to 298:464/514 of P02916
>GFF1917 FitnessBrowser__Phaeo:GFF1917
MKTYLRSSKFVARLAITPFVVIVLLIFVGCVGWSVQLSFTNSKLLPNGDFVGLDQYYRLF
RTTRWIVSLKNMLLFGVFFVSGALILGFLLAILLDQKIRAEAFFRTIFLYPYSLSFVVTG
LAWQWFLNPSLGLQNAVRELGWSSFTFDWLTDQSMAIYTIVIAAIWHGSGLVMALMLAGL
RGVDPEIWRASKIDGIPTWRVYVHIVAPILGPVIFASVVLLSLSVVKGFDIVVAMTNGGP
GIATEVPAKFVLDHILERANVGLAMAGATIMLITVISALAPWLYVQHMRKRNSP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory