SitesBLAST
Comparing GFF1925 FitnessBrowser__psRCH2:GFF1925 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
24% identity, 62% coverage: 124:386/427 of query aligns to 92:349/369 of O31616
- V174 (≠ A209) binding
- H244 (≠ Y277) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (≠ F341) binding
- 327:333 (vs. 364:370, 14% identical) binding
- R329 (≠ G366) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
24% identity, 62% coverage: 124:386/427 of query aligns to 92:349/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (= Y288), R302 (≠ F341), R329 (≠ G366)
- binding flavin-adenine dinucleotide: V174 (≠ A209), S202 (≠ G236), G203 (≠ N237), W205 (≠ Y239), F209 (≠ L243), G300 (= G339), R302 (≠ F341), H327 (≠ C364), R329 (≠ G366), N330 (≠ H367), G331 (= G368), I332 (≠ V369)
- binding phosphate ion: R254 (= R296)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
24% identity, 62% coverage: 124:386/427 of query aligns to 92:349/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (= P208), V174 (≠ A209), S202 (≠ G236), G203 (≠ N237), W205 (≠ Y239), F209 (≠ L243), G300 (= G339), R302 (≠ F341), H327 (≠ C364), F328 (≠ S365), R329 (≠ G366), N330 (≠ H367), G331 (= G368), I332 (≠ V369)
- binding glycolic acid: Y246 (= Y288), R302 (≠ F341), R329 (≠ G366)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
22% identity, 84% coverage: 31:388/427 of query aligns to 3:349/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I35), G8 (= G36), G10 (= G38), V11 (≠ Y39), I12 (≠ T40), V30 (≠ L58), E31 (= E59), K32 (≠ A60), E38 (≠ G66), A39 (= A67), S40 (= S68), A43 (≠ N71), G45 (= G73), L46 (≠ Q74), V171 (≠ A209), G200 (= G236), G201 (≠ N237), W203 (≠ Y239), G298 (= G339), R300 (≠ F341), P301 (≠ L342), Y326 (vs. gap), R327 (vs. gap), N328 (vs. gap), G329 (= G368), I330 (≠ V369)
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
25% identity, 86% coverage: 28:393/427 of query aligns to 3:359/369 of S5FMM4
- G51 (≠ V76) mutation to S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- A54 (≠ Y79) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- K81 (≠ A102) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
- S202 (≠ G236) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ V369) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ I379) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
23% identity, 85% coverage: 28:391/427 of query aligns to 23:374/383 of 5i39A
- active site: F66 (≠ N71), Q69 (= Q74), A70 (≠ I75), Q248 (≠ S251), P267 (= P274)
- binding flavin-adenine dinucleotide: V30 (≠ I35), G31 (= G36), G33 (= G38), I34 (≠ Y39), L35 (≠ T40), V53 (≠ L58), E54 (= E59), K55 (≠ A60), Q62 (≠ A67), S63 (= S68), F66 (≠ N71), Y67 (≠ G72), Q69 (= Q74), A196 (≠ P208), A197 (= A209), G226 (= G236), G227 (≠ N237), W229 (≠ Y239), Q248 (≠ S251), Q250 (≠ T256), G321 (= G339), M323 (≠ F341), T348 (≠ S365), G349 (= G366), W350 (≠ H367), G351 (= G368), M352 (≠ V369), T353 (= T370)
Query Sequence
>GFF1925 FitnessBrowser__psRCH2:GFF1925
MPNKGYPASYYAATANSATARSELQDNKQVDVCVIGAGYTGLSTALFLLEKGYSVAVLEA
AKVGFGASGRNGGQIVNSYSRDLDSIERTASAAAAKLIGEMAFEGGRIIRERVARYDIQC
DLKDGGVFAAFNQKQMLHLETQKALWERYGYQHLELLDDRGIRQVVACDRYVGGMLDKHG
GHIHPLNLALGEAAAVESLGGTIHEHSPAIRIERGETPLVHTPKGTVRAKFVVIAGNAYL
GNLVPELAAKSMPCGTQVIATEPLSEELAHSLLPQDYCVEDCNYLLDYYRLAADKRLIYG
GGVVYGARDPADIESIIRPKMLKTFPQLEKVKIDYAWTGNFLLTLSRLPQVGRLGGNIYY
SQGCSGHGVTYTHVAGKVIAEALSGQAERFDAFASLPHYPFPGGQRLQVPLSALGAMYYN
LRDRLGF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory