Comparing GFF194 FitnessBrowser__Phaeo:GFF194 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
57% identity, 94% coverage: 22:338/338 of query aligns to 5:324/324 of 4z9nB
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
31% identity, 68% coverage: 23:253/338 of query aligns to 1:218/229 of 5t0wA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
25% identity, 64% coverage: 23:239/338 of query aligns to 5:213/251 of 1xt8B
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
27% identity, 64% coverage: 11:225/338 of query aligns to 30:236/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
27% identity, 64% coverage: 11:225/338 of query aligns to 30:236/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
27% identity, 64% coverage: 11:225/338 of query aligns to 31:237/288 of 6h2tA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
28% identity, 64% coverage: 31:246/338 of query aligns to 3:211/226 of 4zv1A
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
29% identity, 57% coverage: 55:248/338 of query aligns to 37:222/243 of 5eyfB
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
28% identity, 64% coverage: 31:248/338 of query aligns to 3:210/234 of 3k4uE
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
28% identity, 64% coverage: 31:246/338 of query aligns to 3:209/225 of 4zv2A
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
25% identity, 64% coverage: 23:239/338 of query aligns to 1:211/231 of 2v25A
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
26% identity, 67% coverage: 22:249/338 of query aligns to 1:216/247 of 2yjpA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
21% identity, 66% coverage: 17:239/338 of query aligns to 1:225/278 of 2ia4B
2vhaA Debp (see paper)
21% identity, 65% coverage: 20:239/338 of query aligns to 3:224/276 of 2vhaA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
24% identity, 66% coverage: 25:246/338 of query aligns to 3:213/229 of 6svfA
>GFF194 FitnessBrowser__Phaeo:GFF194
MKNKVILGALTIAGLAAGAAAAGTLDDVKARGKLNCGVTTGLVGFAAPNANGEWEGFDVA
VCRAVAAAVLGDSTAVEFVPTTGKTRFTALASGEIDMLARNTTWTFSRDVDLKFEFVGVN
YYDGQGFMVPKELGVSSAKELDGATVCIQTGTTTELNLADFFRSNNISYEPVPIETNAEA
QQQYLAGACDVYTTDASGLAATRATFDDPSAHVLLPEIISKEPLGPLVRHGDHEWGDVVR
WSLNALVAAEELGVTSANIGEMAAGTENPEINRLLGTEGTLGEMLGLSADWAKNAIGAGG
NYGEVFAKNIGEDTPIGLARGLNAQWTEGGLLYAPPFR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory