SitesBLAST
Comparing GFF1943 FitnessBrowser__psRCH2:GFF1943 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
57% identity, 58% coverage: 311:742/747 of query aligns to 1:432/440 of 3slhD
- active site: K23 (= K333), S24 (= S334), D50 (= D360), N95 (= N404), R125 (= R434), D317 (= D627), E345 (= E655), H388 (= H698), R389 (= R699), T415 (= T725)
- binding glyphosate: K23 (= K333), G97 (= G406), T98 (= T407), R125 (= R434), Q171 (= Q481), D317 (= D627), E345 (= E655), R348 (= R658), H388 (= H698), R389 (= R699)
- binding shikimate-3-phosphate: S24 (= S334), R28 (= R338), S169 (= S479), Q171 (= Q481), R196 (= R506), D317 (= D627), K344 (= K654)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S334), R28 (= R338), T98 (= T407), Q171 (= Q481), R196 (= R506), D317 (= D627), K344 (= K654)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
58% identity, 57% coverage: 319:742/747 of query aligns to 7:430/438 of Q83E11
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
58% identity, 58% coverage: 311:742/747 of query aligns to 1:428/434 of 4egrA
- active site: K23 (= K333), S24 (= S334), D50 (= D360), N95 (= N404), R125 (= R434), D313 (= D627), E341 (= E655), H384 (= H698), R385 (= R699), T411 (= T725)
- binding phosphoenolpyruvate: K23 (= K333), G97 (= G406), T98 (= T407), R125 (= R434), D313 (= D627), E341 (= E655), R344 (= R658), R385 (= R699)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
48% identity, 55% coverage: 323:731/747 of query aligns to 10:418/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
48% identity, 55% coverage: 323:731/747 of query aligns to 10:418/427 of 1rf6A
- active site: K20 (= K333), S21 (= S334), D47 (= D360), N90 (= N404), D115 (≠ A429), R120 (= R434), D312 (= D627), E340 (= E655), H384 (= H698), R385 (= R699), T412 (= T725)
- binding glyphosate: K20 (= K333), G92 (= G406), T93 (= T407), R120 (= R434), Q168 (= Q481), D312 (= D627), E340 (= E655), R343 (= R658), H384 (= H698), R385 (= R699)
- binding shikimate-3-phosphate: S21 (= S334), R25 (= R338), S166 (= S479), Q168 (= Q481), R193 (= R506), I311 (= I626), D312 (= D627), K339 (= K654)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
48% identity, 55% coverage: 323:731/747 of query aligns to 10:418/427 of 1rf4A
- active site: K20 (= K333), S21 (= S334), D47 (= D360), N90 (= N404), D115 (≠ A429), R120 (= R434), D312 (= D627), E340 (= E655), H384 (= H698), R385 (= R699), T412 (= T725)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K333), S21 (= S334), R25 (= R338), G92 (= G406), T93 (= T407), R120 (= R434), S166 (= S479), A167 (= A480), Q168 (= Q481), R193 (= R506), D312 (= D627), K339 (= K654), E340 (= E655), R343 (= R658), H384 (= H698), R385 (= R699)
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
48% identity, 56% coverage: 323:742/747 of query aligns to 13:443/445 of 2pqcA
- active site: K23 (= K333), S24 (= S334), D50 (= D360), N93 (= N404), R123 (= R434), D321 (= D627), E349 (= E655), H399 (= H698), R400 (= R699), T426 (= T725)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K333), S24 (= S334), R28 (= R338), T96 (= T407), R123 (= R434), S168 (= S479), Q170 (= Q481), D321 (= D627), K348 (= K654), E349 (= E655), R352 (= R658), R400 (= R699)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
48% identity, 56% coverage: 323:742/747 of query aligns to 13:443/445 of 2pqbA
- active site: K23 (= K333), S24 (= S334), D50 (= D360), N93 (= N404), R123 (= R434), D321 (= D627), E349 (= E655), H399 (= H698), R400 (= R699), T426 (= T725)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K333), S24 (= S334), R28 (= R338), A95 (≠ G406), T96 (= T407), R123 (= R434), S168 (= S479), Q170 (= Q481), D321 (= D627), K348 (= K654), E349 (= E655), R352 (= R658), R400 (= R699)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
48% identity, 56% coverage: 323:742/747 of query aligns to 13:443/445 of 2ggaA
- active site: K23 (= K333), S24 (= S334), D50 (= D360), N93 (= N404), R123 (= R434), D321 (= D627), E349 (= E655), H399 (= H698), R400 (= R699), T426 (= T725)
- binding glyphosate: K23 (= K333), A94 (≠ S405), A95 (≠ G406), T96 (= T407), R123 (= R434), D321 (= D627), E349 (= E655), R352 (= R658), R400 (= R699)
- binding shikimate-3-phosphate: S24 (= S334), R28 (= R338), S168 (= S479), A169 (= A480), Q170 (= Q481), R195 (= R506), D321 (= D627), K348 (= K654)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
48% identity, 56% coverage: 323:742/747 of query aligns to 13:443/445 of 2gg6A
- active site: K23 (= K333), S24 (= S334), D50 (= D360), N93 (= N404), R123 (= R434), D321 (= D627), E349 (= E655), H399 (= H698), R400 (= R699), T426 (= T725)
- binding shikimate-3-phosphate: S24 (= S334), R28 (= R338), T96 (= T407), S168 (= S479), Q170 (= Q481), D321 (= D627), K348 (= K654)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
48% identity, 56% coverage: 323:742/747 of query aligns to 18:448/455 of Q9R4E4
- KS 28:29 (= KS 333:334) binding
- R33 (= R338) binding
- NAAT 98:101 (≠ NSGT 404:407) Phosphoenolpyruvate
- A100 (≠ G406) mutation to G: Confers resistance to glyphosate.
- R128 (= R434) binding
- K353 (= K654) binding
- R357 (= R658) binding
- R405 (= R699) binding
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
38% identity, 37% coverage: 14:292/747 of query aligns to 5:282/285 of 3ggoA
- binding 3-(4-hydroxy-phenyl)pyruvic acid: G217 (≠ A227), G218 (= G228), G219 (= G229)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V13 (≠ L22), G14 (= G23), F15 (≠ L24), M16 (≠ I25), D37 (= D46), I38 (≠ L47), S42 (= S51), S73 (≠ A81), S74 (≠ T82), P75 (= P83), T78 (≠ A86), Q99 (≠ V107), S101 (= S109), A125 (= A136), G131 (= G142), M233 (= M243)
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
38% identity, 37% coverage: 14:292/747 of query aligns to 13:290/293 of 3gggD
- binding nicotinamide-adenine-dinucleotide: V21 (≠ L22), G22 (= G23), F23 (≠ L24), M24 (≠ I25), D45 (= D46), I46 (≠ L47), S50 (= S51), S81 (≠ A81), S82 (≠ T82), P83 (= P83), V84 (≠ I84), T86 (≠ A86), Q107 (≠ V107), S109 (= S109), G134 (= G137), T135 (≠ S138)
- binding tyrosine: G225 (≠ A227), G226 (= G228)
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
38% identity, 37% coverage: 14:292/747 of query aligns to 5:282/286 of 3ggpA
- binding hydroxyphenyl propionic acid: G218 (= G228), G219 (= G229)
- binding nicotinamide-adenine-dinucleotide: V13 (≠ L22), G14 (= G23), F15 (≠ L24), M16 (≠ I25), D37 (= D46), I38 (≠ L47), S42 (= S51), S73 (≠ A81), S74 (≠ T82), P75 (= P83), T78 (≠ A86), Q99 (≠ V107), S101 (= S109), G131 (= G142), M233 (= M243)
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
42% identity, 38% coverage: 7:292/747 of query aligns to 1:283/293 of 4wjiA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G21), G13 (= G23), L14 (= L24), I15 (= I25), T36 (≠ D46), R37 (≠ L47), S38 (≠ D48), T41 (≠ S51), S71 (≠ A81), V72 (≠ T82), P73 (= P83), A76 (= A86), V97 (= V107), S99 (= S109), A125 (= A136), S130 (= S141), M234 (= M243)
- binding tyrosine: S99 (= S109), H122 (= H133), A125 (= A136), T127 (≠ S138), R226 (= R235)
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
36% identity, 37% coverage: 17:294/747 of query aligns to 9:284/286 of 3b1fA
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
36% identity, 37% coverage: 15:293/747 of query aligns to 2:280/365 of 6u60B
- binding nicotinamide-adenine-dinucleotide: G10 (= G23), L11 (= L24), I12 (= I25), D32 (= D46), I33 (≠ L47), A67 (= A81), P69 (= P83), E72 (≠ A86), V94 (= V107), S96 (= S109), G128 (= G142)
- binding tyrosine: K126 (≠ L140)
Sites not aligning to the query:
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
37% identity, 37% coverage: 15:293/747 of query aligns to 10:288/373 of 5uyyA
Sites not aligning to the query:
7tm6A Crystal structure of shikimate-3-phosphate and glyphosate bound 3- phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae
30% identity, 55% coverage: 318:731/747 of query aligns to 6:416/426 of 7tm6A
- binding glyphosate: K21 (= K333), G95 (= G406), R123 (= R434), Q170 (= Q481), D312 (= D627), E340 (= E655), R343 (= R658), H384 (= H698), R385 (= R699)
- binding shikimate-3-phosphate: S22 (= S334), R26 (= R338), T96 (= T407), S168 (= S479), S169 (≠ A480), Q170 (= Q481), S196 (≠ P502), Y199 (≠ T505), D312 (= D627), N335 (≠ E650), K339 (= K654)
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
30% identity, 55% coverage: 318:731/747 of query aligns to 7:417/427 of 7tm5B
- binding shikimate-3-phosphate: K22 (= K333), S23 (= S334), R27 (= R338), S169 (= S479), S170 (≠ A480), Q171 (= Q481), S197 (≠ P502), Y200 (≠ T505), D313 (= D627), N336 (≠ E650), K340 (= K654)
Query Sequence
>GFF1943 FitnessBrowser__psRCH2:GFF1943
MNHARHAQQPSPILNRLVVIGLGLIGGSFAKGLREAGLCREVVGFDLDARSRELAVELGV
VDRCADTLAEACHGADVIQLATPILALERLLGELAKLELGGAVITDVGSAKGNVVRCARN
VFGEMPSRFVPGHPIAGSELSGVTAANSTLFRRHKVILTPLENTDPQALALVTKLWSALG
ADVEHMGVAHHDEVLAATSHLPHLLAFGLVDSLAKRHENLEIFRYAAGGFRDFTRIAGSD
PVMWHDIFLANREAVLHTLDDFRADLDALRAAVDEGDGHRLLGVFTRAKAAREHFSKILA
RRAYVDVMHSNDLVFLANPGGSLTGHLRVPGDKSISHRSIMLGSLAEGTTEVEGFLEGED
ALATIQAFRDMGVVIEGPHQGRVTVHGVGLHGLKAPPGPIYLGNSGTSMRLLSGLLAAQP
FDTTLTGDASLSKRPMNRVAKPLREMGAVIETAPDGRPPLTIRGGQRLSGMHYEMPMASA
QVKSCLLLAGLYAAGQTSVTEPAPTRDHTERMLRGFGYPVTVKGSTALVEPGHKLQATHI
EVPADISSAAFFMVAASIAQGSEIVLEHVGVNPTRTGVIDILKLMGGDISLENPREVGGE
PVADIRVRGAQLKGIDIPEDLVPLAIDEFPVLFVAAACAEGRTTLRGAEELRVKESDRIQ
VMADGLQTLGVKAEPTPDGIVIEGGAIGSGEVWAHGDHRIAMSFSVAALRASGPVRIHDC
ANVATSFPNFLALAQRAGMQVHSEGDS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory