Comparing GFF1960 FitnessBrowser__Phaeo:GFF1960 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
55% identity, 96% coverage: 11:319/322 of query aligns to 11:318/323 of 4dz4B
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
46% identity, 78% coverage: 47:296/322 of query aligns to 34:282/306 of P60651
7lbaB E. Coli agmatinase (see paper)
46% identity, 78% coverage: 47:296/322 of query aligns to 41:289/310 of 7lbaB
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
46% identity, 78% coverage: 47:296/322 of query aligns to 24:272/294 of 7lolA
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
45% identity, 78% coverage: 47:296/322 of query aligns to 20:262/284 of 7loxA
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
37% identity, 89% coverage: 28:314/322 of query aligns to 15:308/316 of 3nipB
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
37% identity, 89% coverage: 28:314/322 of query aligns to 17:310/318 of Q9I6K2
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
37% identity, 89% coverage: 28:314/322 of query aligns to 14:307/315 of 3niqA
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
38% identity, 89% coverage: 28:314/322 of query aligns to 17:313/319 of Q9I3S3
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
38% identity, 89% coverage: 28:314/322 of query aligns to 14:310/316 of 3nioA
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
36% identity, 87% coverage: 33:311/322 of query aligns to 17:302/313 of P0DJQ3
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
36% identity, 87% coverage: 33:311/322 of query aligns to 9:294/301 of 1gq6B
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
31% identity, 83% coverage: 47:314/322 of query aligns to 6:270/276 of 3lhlA
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
31% identity, 89% coverage: 28:312/322 of query aligns to 54:348/378 of 7esrA
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
31% identity, 83% coverage: 49:314/322 of query aligns to 24:283/284 of Q57757
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
32% identity, 89% coverage: 26:312/322 of query aligns to 5:296/303 of 1wogA
G7JFU5 Arginase, mitochondrial; Agmatinase ARGAH; Arginine amidohydrolase; MtARGAH; EC 3.5.3.1; EC 3.5.3.11 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
29% identity, 89% coverage: 26:310/322 of query aligns to 37:332/338 of G7JFU5
6vstA Arginase from medicago truncatula in complex with ornithine (see paper)
29% identity, 89% coverage: 26:310/322 of query aligns to 16:311/317 of 6vstA
6vstD Arginase from medicago truncatula in complex with ornithine (see paper)
29% identity, 89% coverage: 26:310/322 of query aligns to 19:314/320 of 6vstD
P46637 Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; AtARGAH1; EC 3.5.3.1; EC 3.5.3.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 81% coverage: 49:310/322 of query aligns to 66:336/342 of P46637
Sites not aligning to the query:
>GFF1960 FitnessBrowser__Phaeo:GFF1960
MALEDAKHMIDHAFTREDMKGLSFEITFGGATSFLRRKYTKDLTGVDIAVTGVPFDQAVT
NRPGTRLGPRAIREASCLQSPDEPYGWPHKPLSTLAIADYGDLAFDHADVPAFPAALTDH
IRGILATETASVVLGGDHYISFPILKAYAEKHGPISLLQFDAHTDTWPDDNMDRIDHGTM
FYKAVKMGLVDPKTSVQVGIRTTNDDTLGVNIIDAPTVHDIGPVETAKRIKAILGDRPTY
LTFDIDCLDPAYAPGTGTPVWGGLTSAQASRILREIAGINIKGGDVVEVSPPFDTTGATA
IAGAHVATEIICLLGWNMRDND
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory