Comparing GFF1961 FitnessBrowser__Phaeo:GFF1961 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
39% identity, 92% coverage: 18:383/397 of query aligns to 14:371/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 98% coverage: 9:396/397 of query aligns to 43:436/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 94% coverage: 9:383/397 of query aligns to 47:422/442 of P54968
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
34% identity, 92% coverage: 13:377/397 of query aligns to 15:377/389 of 4ewtA
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
34% identity, 94% coverage: 3:374/397 of query aligns to 8:376/398 of 6slfA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
26% identity, 46% coverage: 114:294/397 of query aligns to 112:293/380 of 5vo3A
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
26% identity, 46% coverage: 114:294/397 of query aligns to 108:289/377 of P44514
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
26% identity, 74% coverage: 5:299/397 of query aligns to 5:275/391 of 3ramA
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
25% identity, 46% coverage: 114:294/397 of query aligns to 108:289/377 of 7t1qA
Sites not aligning to the query:
>GFF1961 FitnessBrowser__Phaeo:GFF1961
MPVVNRIADYADEMKTWRRHLHQIPELALDLPKTAAFVAERLREFGVDELHEGIATSGMV
AIINGQGNDAGDGPTIGLRADMDALPIPEETGVDYVSGHAGNMHACGHDGHTTMLLGAAK
YLAETRNFKGRVALIFQPAEEAIGGARIMVEEGIMERFNIGEVYALHNAPGLPVGAFATT
PGPLMAAVDTFHINIQGVGGHGAMPHETRDPVMAACGMAQAIQTIVSRNHYALDDLVVSV
TQIHTGTVDNVIPDTAYINGTVRTFDPRVQEMVMRRMKEIVAGQAASYGVEAELDYEVGY
PATINDASKTGFAASVAGEVAGPENVEAEAGREMGAEDFSYMLQARPGAYLFLGQGDSAG
LHHPKYDFNDEIAPIGASFFARLVERAQPMVNASNDG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory