Comparing GFF1996 FitnessBrowser__Phaeo:GFF1996 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yhvA Crystal structure of an aminotransferase from mycobacterium tuberculosis
47% identity, 99% coverage: 2:380/382 of query aligns to 10:394/394 of 5yhvA
P96847 Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
47% identity, 99% coverage: 2:380/382 of query aligns to 4:388/388 of P96847
5yhvB Crystal structure of an aminotransferase from mycobacterium tuberculosis
47% identity, 99% coverage: 2:380/382 of query aligns to 3:387/387 of 5yhvB
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
34% identity, 97% coverage: 8:377/382 of query aligns to 8:368/370 of Q58097
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
30% identity, 94% coverage: 19:376/382 of query aligns to 24:394/402 of P14909
Sites not aligning to the query:
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
31% identity, 96% coverage: 15:379/382 of query aligns to 23:384/384 of 1o4sB
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
30% identity, 99% coverage: 1:377/382 of query aligns to 1:382/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
30% identity, 99% coverage: 1:377/382 of query aligns to 1:382/382 of 1gc3A
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
30% identity, 99% coverage: 1:377/382 of query aligns to 1:382/382 of 1b5oA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
30% identity, 99% coverage: 1:377/382 of query aligns to 1:382/385 of Q56232
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
30% identity, 99% coverage: 1:377/382 of query aligns to 1:382/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
30% identity, 99% coverage: 1:377/382 of query aligns to 1:382/382 of 1bjwA
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
29% identity, 99% coverage: 2:380/382 of query aligns to 1:393/393 of 1xi9C
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
28% identity, 92% coverage: 29:381/382 of query aligns to 25:386/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
28% identity, 92% coverage: 29:381/382 of query aligns to 25:386/388 of 1gd9A
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
28% identity, 98% coverage: 7:381/382 of query aligns to 8:399/399 of 6f77A
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
28% identity, 98% coverage: 7:381/382 of query aligns to 9:400/400 of Q02635
1j32A Aspartate aminotransferase from phormidium lapideum
28% identity, 99% coverage: 1:377/382 of query aligns to 1:384/388 of 1j32A
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
30% identity, 93% coverage: 17:373/382 of query aligns to 20:384/393 of 6l1lB
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
30% identity, 93% coverage: 17:373/382 of query aligns to 20:384/392 of 6l1oB
Sites not aligning to the query:
>GFF1996 FitnessBrowser__Phaeo:GFF1996
MRNSSRSNVDPFIVMDVMEAARRAEEAGRHIIHMEVGQPSTGAPVAAREALAKALDHDSL
GYTVALGLPALRKRIAQLYGEWYNVDLNPERVVITPGSSGAFLLSFTALFDSGDRVGIGA
PGYPSYRQILHALGLTPVDIETSLDHRLQPVPQDLTGLDLAGLMVASPANPTGTMLDKPA
MAALIDAAQGQGAAFISDEIYHGIEYEAKAVTALEVTDECYVINSFSKYFSMTGWRVGWM
VVPEDHVRVVERIAQNMFICAPHASQVAALAAMDCRDELEGNLAVYARNRALMLEGLPKA
GFDRIAPPDGAFYVYADVSELTHDSRAFAQEILDEAGVAVTPGLDFDPKRGATTLRFSYA
RATADIEEGLTRLAAFMAARRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory