Comparing GFF2008 FitnessBrowser__Phaeo:GFF2008 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
29% identity, 85% coverage: 10:174/193 of query aligns to 4:169/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
29% identity, 85% coverage: 10:174/193 of query aligns to 4:169/207 of 1h2eA
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
29% identity, 84% coverage: 9:170/193 of query aligns to 3:161/196 of 6m1xC
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
33% identity, 74% coverage: 12:153/193 of query aligns to 8:160/223 of P9WIC7
Sites not aligning to the query:
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
33% identity, 74% coverage: 12:153/193 of query aligns to 6:158/209 of 4qihA
5zr2C Crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine (see paper)
28% identity, 84% coverage: 9:170/193 of query aligns to 3:161/198 of 5zr2C
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
33% identity, 74% coverage: 12:153/193 of query aligns to 7:159/217 of 4pzaB
5pgmE Saccharomyces cerevisiae phosphoglycerate mutase (see paper)
34% identity, 52% coverage: 8:108/193 of query aligns to 1:106/234 of 5pgmE
Sites not aligning to the query:
1bq4A Saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate (see paper)
34% identity, 52% coverage: 8:108/193 of query aligns to 1:106/234 of 1bq4A
Sites not aligning to the query:
1bq3A Saccharomyces cerevisiae phosphoglycerate mutase in complex with inositol hexakisphosphate (see paper)
34% identity, 52% coverage: 8:108/193 of query aligns to 1:106/234 of 1bq3A
Sites not aligning to the query:
1qhfA Yeast phosphoglycerate mutase-3pg complex structure to 1.7 a (see paper)
34% identity, 52% coverage: 8:108/193 of query aligns to 1:106/240 of 1qhfA
Sites not aligning to the query:
P00950 Phosphoglycerate mutase 1; PGAM 1; BPG-dependent PGAM 1; MPGM 1; Phosphoglyceromutase 1; EC 5.4.2.11 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 7 papers)
34% identity, 52% coverage: 8:108/193 of query aligns to 2:107/247 of P00950
Sites not aligning to the query:
P18669 Phosphoglycerate mutase 1; BPG-dependent PGAM 1; Phosphoglycerate mutase isozyme B; PGAM-B; EC 5.4.2.11; EC 5.4.2.4 from Homo sapiens (Human) (see 4 papers)
33% identity, 54% coverage: 5:108/193 of query aligns to 1:109/254 of P18669
Sites not aligning to the query:
P62707 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Escherichia coli (strain K12) (see 6 papers)
33% identity, 53% coverage: 5:106/193 of query aligns to 1:107/250 of P62707
Sites not aligning to the query:
1bifA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase bifunctional enzyme complexed with atp-g-s and phosphate (see paper)
29% identity, 74% coverage: 10:152/193 of query aligns to 215:354/432 of 1bifA
Sites not aligning to the query:
5y2iB Phosphoglycerate mutase 1 (pgam1) complexed with its inhibitor pgmi- 004a
32% identity, 52% coverage: 9:108/193 of query aligns to 3:107/233 of 5y2iB
Sites not aligning to the query:
6isnC Phosphoglycerate mutase 1 complexed with a small molecule inhibitor
32% identity, 52% coverage: 9:108/193 of query aligns to 4:108/234 of 6isnC
Sites not aligning to the query:
5zrmC Phosphoglycerate mutase 1 complexed with a small molecule inhibitor in-ac
32% identity, 52% coverage: 9:108/193 of query aligns to 4:108/234 of 5zrmC
Sites not aligning to the query:
5y35C Phosphoglycerate mutase 1 complexed with a small molecule inhibitor kh1
32% identity, 52% coverage: 9:108/193 of query aligns to 4:108/237 of 5y35C
Sites not aligning to the query:
7xb9B Phosphoglycerate mutase 1 complexed with a covalent inhibitor
32% identity, 52% coverage: 9:108/193 of query aligns to 3:107/231 of 7xb9B
Sites not aligning to the query:
>GFF2008 FitnessBrowser__Phaeo:GFF2008
MRAGMAYPKIWFLRHGQTEWNAEGRIQGQLESRLSPLGIEHAQQQAGLMAPILAQGPACY
VSPLGRAQQTARIALGDQPFITDARLAEAQAGVFQGLTRQEVAAEYPEIYAANPLNLDLF
CAAPQGEGFDAFQARITDFLTGLSEPTVVVAHGLWGQVLRGVICGLSRAEMAALPNEQGC
IYQLADGGEQVLR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory