Comparing GFF2032 FitnessBrowser__Phaeo:GFF2032 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
46% identity, 98% coverage: 2:245/250 of query aligns to 4:250/252 of 6neeB
P00942 Triosephosphate isomerase; TIM; Triose-phosphate isomerase; EC 5.3.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
44% identity, 97% coverage: 2:243/250 of query aligns to 3:244/248 of P00942
Sites not aligning to the query:
5eywA Crystal structure of litopenaeus vannamei triosephosphate isomerase complexed with 2-phosphoglycolic acid (see paper)
43% identity, 98% coverage: 2:245/250 of query aligns to 1:243/244 of 5eywA
A0A1L5YRA2 Triosephosphate isomerase; TIM; Allergen Scy p 8; Methylglyoxal synthase; Triose-phosphate isomerase; Allergen Scy p 8.0101; EC 5.3.1.1; EC 4.2.3.3 from Scylla paramamosain (Mud crab) (see paper)
42% identity, 98% coverage: 2:245/250 of query aligns to 5:246/248 of A0A1L5YRA2
P00943 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
45% identity, 98% coverage: 1:245/250 of query aligns to 1:249/253 of P00943
P27876 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Bacillus subtilis (strain 168) (see paper)
44% identity, 97% coverage: 1:243/250 of query aligns to 1:247/253 of P27876
3ypiA Electrophilic catalysis in triosephosphase isomerase: the role of histidine-95 (see paper)
43% identity, 97% coverage: 2:243/250 of query aligns to 2:243/247 of 3ypiA
4ff7B Structure of c126s mutant of saccharomyces cerevisiae triosephosphate isomerase (see paper)
43% identity, 97% coverage: 2:243/250 of query aligns to 2:243/247 of 4ff7B
4ff7A Structure of c126s mutant of saccharomyces cerevisiae triosephosphate isomerase (see paper)
43% identity, 97% coverage: 2:243/250 of query aligns to 2:243/247 of 4ff7A
1btmA Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid (see paper)
45% identity, 98% coverage: 2:245/250 of query aligns to 1:248/251 of 1btmA
1htiB Crystal structure of recombinant human triosephosphate isomerase at 2.8 angstroms resolution. Triosephosphate isomerase related human genetic disorders and comparison with the trypanosomal enzyme (see paper)
44% identity, 98% coverage: 2:245/250 of query aligns to 4:246/248 of 1htiB
4pocB Structure of triosephosphate isomerase wild type human enzyme. (see paper)
44% identity, 98% coverage: 2:245/250 of query aligns to 3:245/247 of 4pocB
P60174 Triosephosphate isomerase; TIM; Methylglyoxal synthase; Triose-phosphate isomerase; EC 5.3.1.1; EC 4.2.3.3 from Homo sapiens (Human) (see 7 papers)
44% identity, 98% coverage: 2:245/250 of query aligns to 5:247/249 of P60174
6oogA Crystal structure of triosephosphate isomerase from taenia solium in complex with 2pg (see paper)
46% identity, 98% coverage: 1:245/250 of query aligns to 3:250/252 of 6oogA
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
42% identity, 94% coverage: 2:237/250 of query aligns to 402:641/654 of P36204
Sites not aligning to the query:
1r2rB Crystal structure of rabbit muscle triosephosphate isomerase (see paper)
43% identity, 98% coverage: 2:245/250 of query aligns to 3:245/247 of 1r2rB
4owgA Crystal structure of rabbit muscle triosephosphate isomerase-pep complex
43% identity, 98% coverage: 2:245/250 of query aligns to 2:244/246 of 4owgA
P00939 Triosephosphate isomerase; TIM; Methylglyoxal synthase; Triose-phosphate isomerase; EC 5.3.1.1; EC 4.2.3.3 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
43% identity, 98% coverage: 2:245/250 of query aligns to 5:247/249 of P00939
P17751 Triosephosphate isomerase; TIM; Methylglyoxal synthase; Triose-phosphate isomerase; EC 5.3.1.1; EC 4.2.3.3 from Mus musculus (Mouse) (see paper)
43% identity, 98% coverage: 2:245/250 of query aligns to 5:247/249 of P17751
6ooiC Crystal structure of triosephosphate isomerase from schistosoma mansoni in complex with 2pg (see paper)
43% identity, 98% coverage: 2:245/250 of query aligns to 8:253/255 of 6ooiC
>GFF2032 FitnessBrowser__Phaeo:GFF2032
MRRKLAAGNWKMNGTASALTELGNLAYSCKSAKAEVLICPPATLLYRAANVCVDSKVSIG
AQDCHDATYGAHTGDLSAEMLHDAGATAVILGHSERRADHDETDETVRAKAKTAIAAGLT
AIICVGETLNDREAGKTLDVVRAQLAGSLPDDASGTTVVVAYEPVWAIGTGKVPTVEQIA
EVHNDMRASLVKRFGGETANAIRLLYGGSVKASNAKEIFAVAHVDGALVGGASLKAADFA
PIVAALDASA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory