Comparing GFF2035 FitnessBrowser__Phaeo:GFF2035 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP from Shewanella loihica (strain ATCC BAA-1088 / PV-4) (see paper)
53% identity, 90% coverage: 31:330/333 of query aligns to 36:335/336 of A3QCW5
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
28% identity, 92% coverage: 9:314/333 of query aligns to 10:311/328 of Q0B2F6
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
27% identity, 83% coverage: 40:314/333 of query aligns to 11:285/301 of 4n17A
Sites not aligning to the query:
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
27% identity, 83% coverage: 40:314/333 of query aligns to 11:285/301 of 4n15A
Sites not aligning to the query:
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
26% identity, 89% coverage: 30:324/333 of query aligns to 6:300/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
26% identity, 89% coverage: 30:324/333 of query aligns to 6:300/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
26% identity, 89% coverage: 30:324/333 of query aligns to 6:300/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
26% identity, 89% coverage: 30:324/333 of query aligns to 6:300/310 of 7bcnA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
26% identity, 89% coverage: 30:324/333 of query aligns to 7:301/310 of 7bbrA
7t3eA Structure of the sialic acid bound tripartite atp-independent periplasmic (trap) periplasmic component siap from photobacterium profundum (see paper)
32% identity, 83% coverage: 47:324/333 of query aligns to 20:295/300 of 7t3eA
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
27% identity, 84% coverage: 36:314/333 of query aligns to 6:287/304 of 4x8rA
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
29% identity, 97% coverage: 8:331/333 of query aligns to 10:326/329 of P44542
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
28% identity, 91% coverage: 28:331/333 of query aligns to 1:302/303 of 4pddA
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
29% identity, 86% coverage: 47:331/333 of query aligns to 20:303/310 of 3b50A
Sites not aligning to the query:
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
29% identity, 86% coverage: 47:331/333 of query aligns to 20:303/309 of 2v4cA
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
29% identity, 85% coverage: 47:329/333 of query aligns to 19:303/305 of 4mnpA
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
29% identity, 86% coverage: 47:331/333 of query aligns to 19:302/305 of 2cexB
Sites not aligning to the query:
2wx9A Crystal structure of the sialic acid binding periplasmic protein siap (see paper)
29% identity, 86% coverage: 47:331/333 of query aligns to 20:303/308 of 2wx9A
Sites not aligning to the query:
2cexA Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
29% identity, 86% coverage: 47:331/333 of query aligns to 19:302/304 of 2cexA
Sites not aligning to the query:
2xwoA Siap r147e mutant in complex with sialylamide (see paper)
29% identity, 86% coverage: 47:331/333 of query aligns to 20:303/308 of 2xwoA
Sites not aligning to the query:
>GFF2035 FitnessBrowser__Phaeo:GFF2035
MKFVTAAATAVALTMSAGTAMAACDDGEIVVKFSHVTNTDKHPKGIAASLLEKRINEEMN
GTMCLEVYPNSTLYNDNKVLEAMLQGDVQLAAPSLSKFEKFTKQFRLFDLPFMFKNIDAV
DAFQGSENGQAMLDSMQRRGLQGLSYWHNGMKQMSANKPLINPSDANGLKFRVQSSDVLV
AQMEAIGGSPQKMAFSEVYGALQQGVVDGQENTWSNIYGKKFFEVQDGVTETNHGALDYL
VVTSVDWLDSLDPAVREQFLTILGEVTATRNSESTKVNAEARQSIIDAGGVVRELTPEQR
AAWVEAMKPVWEQFAGDVGQDMIDAAQAINAGM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory