Comparing GFF204 FitnessBrowser__Marino:GFF204 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
40% identity, 94% coverage: 3:315/332 of query aligns to 4:317/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
40% identity, 94% coverage: 3:315/332 of query aligns to 3:306/310 of 4fwiB
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
35% identity, 96% coverage: 1:320/332 of query aligns to 1:327/330 of P0AAH4
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 77% coverage: 3:259/332 of query aligns to 3:249/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 77% coverage: 3:259/332 of query aligns to 3:249/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
37% identity, 77% coverage: 3:259/332 of query aligns to 3:249/250 of 7z16I
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 72% coverage: 18:257/332 of query aligns to 12:239/240 of 4ymuJ
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 76% coverage: 3:255/332 of query aligns to 2:237/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
33% identity, 72% coverage: 18:257/332 of query aligns to 14:241/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
33% identity, 72% coverage: 18:257/332 of query aligns to 14:241/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
33% identity, 72% coverage: 18:257/332 of query aligns to 14:241/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
33% identity, 72% coverage: 18:257/332 of query aligns to 14:241/242 of 2oljA
Sites not aligning to the query:
8g4cB Bceabs atpgs high res tm (see paper)
33% identity, 74% coverage: 23:269/332 of query aligns to 23:237/248 of 8g4cB
Sites not aligning to the query:
7tchB Bceab e169q variant atp-bound conformation (see paper)
33% identity, 74% coverage: 23:269/332 of query aligns to 22:236/245 of 7tchB
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
34% identity, 66% coverage: 14:232/332 of query aligns to 12:220/226 of 5xu1B
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
31% identity, 72% coverage: 16:254/332 of query aligns to 35:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
31% identity, 72% coverage: 16:254/332 of query aligns to 35:263/382 of 7aheC
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 73% coverage: 22:263/332 of query aligns to 20:250/343 of P30750
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
31% identity, 71% coverage: 16:251/332 of query aligns to 35:260/260 of 7ahdC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 73% coverage: 22:263/332 of query aligns to 21:251/344 of 6cvlD
Sites not aligning to the query:
>GFF204 FitnessBrowser__Marino:GFF204
MALLEVKDLDVRFAVRGGDLTALRGISFSLDKGERLGLVGESGAGKSVAAFSILNLIAKP
GYIAGGQILFEGRDLAAMSERELRRIRGNRIAMIFQDPMMTLNPVLTIGTQMVEAILAHR
KISKKEARAIALDRLQKVQIPSPEKRLDQYPHELSGGMRQRVIIAIALLLDPEIIIADEP
TTALDVTIQAEIMDLLLNLCEQENVALMLITHDLGVVSQVTQRMLVMYSGRIIEQGPTRE
IINDAQHPYTQGLINALPQMGEPGERLFQIPGSMPSLKNVPSGCPFHPRCNFATEQCKQA
MPEYVRSGNVNVACYEVANLIEQEKRMQEAES
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory