Comparing GFF2046 FitnessBrowser__WCS417:GFF2046 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
26% identity, 98% coverage: 7:403/406 of query aligns to 3:416/425 of O59010
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
27% identity, 95% coverage: 19:403/406 of query aligns to 7:408/408 of 6bauA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
27% identity, 95% coverage: 19:403/406 of query aligns to 7:408/409 of 6bavA
2nwwA Crystal structure of gltph in complex with tboa (see paper)
27% identity, 95% coverage: 19:403/406 of query aligns to 6:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
26% identity, 98% coverage: 7:403/406 of query aligns to 3:416/419 of 6x15A
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
26% identity, 97% coverage: 9:403/406 of query aligns to 2:413/413 of 6x14A
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
28% identity, 74% coverage: 19:317/406 of query aligns to 7:322/396 of 6bmiA
Sites not aligning to the query:
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
26% identity, 98% coverage: 7:403/406 of query aligns to 1:418/427 of 5e9sA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
26% identity, 98% coverage: 7:403/406 of query aligns to 1:418/426 of 6xwnB
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
27% identity, 88% coverage: 45:403/406 of query aligns to 38:407/416 of 6r7rA
Sites not aligning to the query:
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
27% identity, 68% coverage: 127:403/406 of query aligns to 126:415/424 of 6zl4A
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
27% identity, 68% coverage: 127:403/406 of query aligns to 127:416/425 of 6zgbA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
27% identity, 61% coverage: 146:392/406 of query aligns to 154:393/412 of 7awmA
Sites not aligning to the query:
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
26% identity, 59% coverage: 138:378/406 of query aligns to 233:479/543 of P56564
Sites not aligning to the query:
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
27% identity, 61% coverage: 146:392/406 of query aligns to 147:379/397 of 5mjuA
Sites not aligning to the query:
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
26% identity, 59% coverage: 138:378/406 of query aligns to 233:479/542 of P43003
Sites not aligning to the query:
6mpbB Cryo-em structure of the human neutral amino acid transporter asct2 (see paper)
28% identity, 61% coverage: 146:392/406 of query aligns to 188:435/446 of 6mpbB
7bcsA Asct2 in the presence of the inhibitor lc-bpe (position "down") in the outward-open conformation. (see paper)
28% identity, 61% coverage: 146:392/406 of query aligns to 184:431/442 of 7bcsA
7bcqA Asct2 in the presence of the inhibitor lc-bpe (position "up") in the outward-open conformation. (see paper)
28% identity, 61% coverage: 146:392/406 of query aligns to 184:431/442 of 7bcqA
Sites not aligning to the query:
Q15758 Neutral amino acid transporter B(0); ATB(0); Baboon M7 virus receptor; RD114/simian type D retrovirus receptor; Sodium-dependent neutral amino acid transporter type 2; Solute carrier family 1 member 5 from Homo sapiens (Human) (see 2 papers)
28% identity, 61% coverage: 146:392/406 of query aligns to 230:477/541 of Q15758
Sites not aligning to the query:
>GFF2046 FitnessBrowser__WCS417:GFF2046
MTAAPSLLQRLARVSLVTQIVIGLIAGILLALLLPEAAKATGFIGKVFVTALKAVAPILV
FVLVMASIANHKHGQETHIKPILFLYLLGTFAAAVVAVIASMWFPSSLVLATHDATVSAP
GGIGEVLQSLLLSVVDNPVSALMNANFIGILAWAIGMGVAIRHAGETTRTLLDDLSNGVT
LIVRVVIRFAPLGIFGLVASTLATSGFGALLGYAHLLVVLIGCMLFVALVVNPAIVFWKL
RRNPYPLVLMCLRESGITAFFTRSSAANIPVNLALSKRLGLHEDTYSVSIPLGATINMAG
AAITITVLTLAAVHTLGIAVDLPTAVLLSVVAAICACGASGVAGGSLLLIPLACSLFGIP
SDIAMQVVAVGFIIGVLQDSAETALNSSTDVLFTAAACLGKEEQPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory