Comparing GFF205 FitnessBrowser__Marino:GFF205 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
34% identity, 90% coverage: 35:335/336 of query aligns to 17:323/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
33% identity, 89% coverage: 35:333/336 of query aligns to 16:310/310 of 4fwiB
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
34% identity, 83% coverage: 32:310/336 of query aligns to 13:305/330 of P0AAH4
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 76% coverage: 32:286/336 of query aligns to 11:260/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 76% coverage: 32:286/336 of query aligns to 12:261/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 76% coverage: 32:286/336 of query aligns to 12:261/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 76% coverage: 32:286/336 of query aligns to 12:261/344 of 6cvlD
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 80% coverage: 35:304/336 of query aligns to 14:278/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 80% coverage: 35:304/336 of query aligns to 14:278/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 80% coverage: 35:304/336 of query aligns to 14:278/353 of 1oxuA
Sites not aligning to the query:
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
30% identity, 80% coverage: 35:304/336 of query aligns to 14:278/353 of Q97UY8
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 69% coverage: 39:270/336 of query aligns to 15:239/241 of 4u00A
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
30% identity, 87% coverage: 34:324/336 of query aligns to 34:337/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
30% identity, 87% coverage: 34:324/336 of query aligns to 34:337/382 of 7aheC
7ahdC Opua (e190q) occluded (see paper)
31% identity, 69% coverage: 34:264/336 of query aligns to 34:260/260 of 7ahdC
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 69% coverage: 38:270/336 of query aligns to 13:239/240 of 4ymuJ
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
32% identity, 69% coverage: 39:271/336 of query aligns to 19:247/375 of 2d62A
3c4jA Abc protein artp in complex with atp-gamma-s
33% identity, 71% coverage: 31:270/336 of query aligns to 8:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
33% identity, 71% coverage: 31:270/336 of query aligns to 8:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
33% identity, 71% coverage: 31:270/336 of query aligns to 8:241/242 of 2olkA
>GFF205 FitnessBrowser__Marino:GFF205
MTSPLVSIRGLEKRFDLSGSLLEQITFEGGRFRRKQEAVHAINGVDLEVQKGEALCVVGE
SGCGKSTVARTVMGLLSPSAGEIHYDGQRIDNLERKDSLPYRRKMQMIFQNPYASLNPRM
TIQQTLEEPIRFHHPDWSPVQVRDKIHEVMHSVGIDQDWGNRFGHEFSGGQRQRIAIARA
LAVDPEFIVADEPISALDVSIQAQVLNLLMDAQESRGLTYLFITHDLAVVEHFGTRVAVM
YLGRVCELADTKTLFSAPRHPYTQALLSAIPKLEDDRPNHIRLKGEVPTPVNLPSGCVFH
GRCPYANERCRQELPQLITTDGGTQVACHAVEEGRL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory