Comparing GFF205 FitnessBrowser__psRCH2:GFF205 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
25% identity, 68% coverage: 25:245/324 of query aligns to 2:215/302 of 8hkbA
Sites not aligning to the query:
7ndrD Crystal structure of tphc in an open conformation (see paper)
22% identity, 77% coverage: 67:316/324 of query aligns to 42:287/293 of 7ndrD
7ndsA Crystal structure of tphc in a closed conformation (see paper)
22% identity, 77% coverage: 67:316/324 of query aligns to 42:287/294 of 7ndsA
Sites not aligning to the query:
2dvzA Structure of a periplasmic transporter (see paper)
24% identity, 39% coverage: 124:248/324 of query aligns to 103:222/300 of 2dvzA
Sites not aligning to the query:
5okuA R. Palustris rpa4515 with adipate (see paper)
30% identity, 37% coverage: 126:245/324 of query aligns to 104:218/299 of 5okuA
Sites not aligning to the query:
5oeiA R. Palustris rpa4515 with oxoadipate (see paper)
30% identity, 37% coverage: 126:245/324 of query aligns to 104:218/299 of 5oeiA
Sites not aligning to the query:
2f5xB Structure of periplasmic binding protein bugd (see paper)
30% identity, 41% coverage: 126:259/324 of query aligns to 103:224/300 of 2f5xB
Sites not aligning to the query:
>GFF205 FitnessBrowser__psRCH2:GFF205
MKTRLSRIALLSSCLLLSSQLLAEPKRPECIAPAKPGGGFDLTCKLAQSGLKDAGLLKAP
MRVTYMPGGVGAVAYNAVVAQRAAEAGTITAFSSGSLLNLAQGKFGRYDESAVRWLAAVG
TDYGAISVRADAPYQNLDELIAAVKKDPGSVVFGAGATIGGQDWMQTALIARAAGVDPQK
LRYVAFEGGGETLTAMLGGHVQVTSSGLGEVTPQLDAGKIRILAVLSDERLPGKLNGIPT
AKEQGYDISWPVIRGFYMGPEVSDEDFNWWKTQFDTLLGDEDFAKLREQRDLFPLSMTGD
ELKAFVEKQVQDYKALAGEFGLVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory