SitesBLAST
Comparing GFF2074 FitnessBrowser__Phaeo:GFF2074 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4o6rA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
44% identity, 99% coverage: 3:485/488 of query aligns to 3:487/489 of 4o6rA
- active site: N150 (= N150), K173 (= K173), E248 (= E248), C282 (= C282), E383 (= E380), E460 (= E457)
- binding adenosine monophosphate: I146 (≠ V146), V147 (= V147), K173 (= K173), G206 (= G206), G210 (= G210), Q211 (≠ A211), F224 (= F224), G226 (= G226), S227 (≠ G227), T230 (= T230), R233 (≠ H233)
5gtlA NADPH complex structure of aldehyde dehydrogenase from bacillus cereus
41% identity, 97% coverage: 2:475/488 of query aligns to 15:489/491 of 5gtlA
- active site: N165 (= N150), K188 (= K173), E263 (= E248), C297 (= C282), E394 (= E380), E471 (= E457)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I161 (≠ V146), P163 (= P148), K188 (= K173), A190 (≠ S175), E191 (= E176), Q192 (≠ E177), G221 (= G206), G225 (= G210), G241 (= G226), S242 (≠ G227), T245 (= T230), L264 (= L249), C297 (= C282), E394 (= E380), F396 (= F382)
5gtkA NAD+ complex structure of aldehyde dehydrogenase from bacillus cereus
41% identity, 97% coverage: 2:475/488 of query aligns to 15:489/491 of 5gtkA
- active site: N165 (= N150), K188 (= K173), E263 (= E248), C297 (= C282), E394 (= E380), E471 (= E457)
- binding nicotinamide-adenine-dinucleotide: I161 (≠ V146), I162 (≠ V147), P163 (= P148), W164 (= W149), K188 (= K173), E191 (= E176), G221 (= G206), G225 (= G210), A226 (= A211), F239 (= F224), G241 (= G226), S242 (≠ G227), T245 (= T230), Y248 (≠ H233), L264 (= L249), C297 (= C282), Q344 (= Q329), R347 (= R332), E394 (= E380), F396 (= F382)
4go4A Crystal structure of pnpe in complex with nicotinamide adenine dinucleotide
43% identity, 97% coverage: 3:476/488 of query aligns to 2:477/487 of 4go4A
- active site: N149 (= N150), K172 (= K173), E247 (= E248), C281 (= C282), E381 (= E380), E458 (= E457)
- binding nicotinamide-adenine-dinucleotide: I145 (≠ V146), V146 (= V147), W148 (= W149), N149 (= N150), F154 (≠ L155), K172 (= K173), G205 (= G206), G209 (= G210), Q210 (≠ A211), F223 (= F224), T224 (= T225), G225 (= G226), S226 (≠ G227), T229 (= T230), E247 (= E248), G249 (= G250), C281 (= C282), E381 (= E380), F383 (= F382)
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
42% identity, 98% coverage: 1:478/488 of query aligns to 1:485/490 of Q9HTJ1
- GAWN 150:153 (≠ VPWN 147:150) binding
- K162 (= K159) active site, Charge relay system
- KPSE 176:179 (≠ KASE 173:176) binding
- G209 (= G206) binding
- GTST 230:233 (≠ GPDT 227:230) binding
- E252 (= E248) active site, Proton acceptor
- C286 (= C282) binding covalent; modified: Cysteine sulfenic acid (-SOH)
- E387 (= E380) binding
- E464 (= E457) active site, Charge relay system
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
42% identity, 98% coverage: 1:478/488 of query aligns to 3:484/489 of 4cazA
- active site: N152 (= N150), K175 (= K173), E251 (= E248), C285 (= C282), E386 (= E380), E463 (= E457)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (≠ V146), G149 (≠ V147), W151 (= W149), N152 (= N150), K175 (= K173), E178 (= E176), G208 (= G206), G212 (= G210), F226 (= F224), T227 (= T225), G228 (= G226), G229 (= G227), T232 (= T230), V236 (= V234), E251 (= E248), L252 (= L249), C285 (= C282), E386 (= E380), F388 (= F382)
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
42% identity, 98% coverage: 1:478/488 of query aligns to 3:484/489 of 2woxA
- active site: N152 (= N150), K175 (= K173), E251 (= E248), C285 (= C282), E386 (= E380), E463 (= E457)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (≠ V146), G149 (≠ V147), W151 (= W149), N152 (= N150), K175 (= K173), S177 (= S175), E178 (= E176), G208 (= G206), G212 (= G210), F226 (= F224), T227 (= T225), G228 (= G226), G229 (= G227), T232 (= T230), V236 (= V234), E251 (= E248), L252 (= L249), C285 (= C282), E386 (= E380), F388 (= F382)
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
42% identity, 98% coverage: 1:478/488 of query aligns to 3:484/489 of 2wmeA
- active site: N152 (= N150), K175 (= K173), E251 (= E248), C285 (= C282), E386 (= E380), E463 (= E457)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (≠ V147), W151 (= W149), K175 (= K173), S177 (= S175), E178 (= E176), G208 (= G206), G212 (= G210), F226 (= F224), G228 (= G226), G229 (= G227), T232 (= T230), V236 (= V234)
4pz2B Structure of zm aldh2-6 (rf2f) in complex with NAD (see paper)
43% identity, 96% coverage: 5:472/488 of query aligns to 12:484/494 of 4pz2B
- active site: N159 (= N150), K182 (= K173), E258 (= E248), C292 (= C282), E392 (= E380), D469 (≠ E457)
- binding nicotinamide-adenine-dinucleotide: I155 (≠ V146), I156 (≠ V147), P157 (= P148), W158 (= W149), N159 (= N150), M164 (≠ L155), K182 (= K173), A184 (≠ S175), E185 (= E176), G215 (= G206), G219 (= G210), F233 (= F224), T234 (= T225), G235 (= G226), S236 (≠ G227), V239 (≠ T230), E258 (= E248), L259 (= L249), C292 (= C282), E392 (= E380), F394 (= F382)
4pxlA Structure of zm aldh2-3 (rf2c) in complex with NAD (see paper)
42% identity, 96% coverage: 5:472/488 of query aligns to 7:476/486 of 4pxlA
- active site: N154 (= N150), K177 (= K173), E253 (= E248), C287 (= C282), E384 (= E380), D461 (≠ E457)
- binding nicotinamide-adenine-dinucleotide: I150 (≠ V146), V151 (= V147), P152 (= P148), W153 (= W149), K177 (= K173), E180 (= E176), G210 (= G206), G214 (= G210), A215 (= A211), F228 (= F224), G230 (= G226), S231 (≠ G227), V234 (≠ T230), E253 (= E248), G255 (= G250), C287 (= C282), Q334 (= Q329), K337 (≠ R332), E384 (= E380), F386 (= F382)
6wsbA Crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei bound to cofactor NAD (see paper)
43% identity, 95% coverage: 7:472/488 of query aligns to 9:477/489 of 6wsbA
- active site: N152 (= N150), E250 (= E248), C284 (= C282), E462 (= E457)
- binding nicotinamide-adenine-dinucleotide: I148 (≠ V146), G149 (≠ V147), A150 (≠ P148), W151 (= W149), N152 (= N150), K175 (= K173), E178 (= E176), G208 (= G206), G211 (= G210), A212 (= A211), F225 (= F224), T226 (= T225), G227 (= G226), G228 (= G227), T231 (= T230), V235 (= V234), E250 (= E248), L251 (= L249), G252 (= G250), C284 (= C282), E385 (= E380), F387 (= F382)
4neaA 1.90 angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betb) from staphylococcus aureus in complex with NAD+ and bme-free cys289 (see paper)
38% identity, 97% coverage: 5:477/488 of query aligns to 19:496/505 of 4neaA
- active site: N166 (= N150), K189 (= K173), E264 (= E248), C298 (= C282), E399 (= E380), E476 (= E457)
- binding nicotinamide-adenine-dinucleotide: P164 (= P148), K189 (= K173), E192 (= E176), G222 (= G206), G226 (= G210), G242 (= G226), G243 (= G227), T246 (= T230), H249 (= H233), I250 (≠ V234), C298 (= C282), E399 (= E380), F401 (= F382)
Q56YU0 Aldehyde dehydrogenase family 2 member C4; ALDH1a; Protein REDUCED EPIDERMAL FLUORESCENCE 1; EC 1.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 97% coverage: 7:480/488 of query aligns to 23:499/501 of Q56YU0
- G152 (≠ V133) mutation to E: In ref1-7; reduced activity on sinapaldehyde.
- G416 (≠ A397) mutation to R: In ref1-6; reduced activity on sinapaldehyde.
8skfA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (lattice translocation disorder)
40% identity, 97% coverage: 1:472/488 of query aligns to 11:486/497 of 8skfA
- binding calcium ion: T33 (≠ S21), I34 (≠ R22), D100 (= D90), V187 (≠ E177)
- binding nicotinamide-adenine-dinucleotide: I156 (≠ V146), G157 (≠ V147), A158 (≠ P148), W159 (= W149), K183 (= K173), E186 (= E176), G216 (= G206), G220 (= G210), T235 (= T225), G236 (= G226), G237 (= G227), S240 (≠ T230), K243 (≠ H233), E259 (= E248), C293 (= C282), F396 (= F382)
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
40% identity, 97% coverage: 1:472/488 of query aligns to 2:477/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
40% identity, 97% coverage: 1:472/488 of query aligns to 2:477/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
40% identity, 97% coverage: 1:472/488 of query aligns to 2:477/488 of 8vqzA
8vqwC Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (coa bound)
40% identity, 97% coverage: 1:472/488 of query aligns to 2:477/488 of 8vqwC
- binding coenzyme a: I147 (≠ V146), W150 (= W149), K174 (= K173), S176 (= S175), E177 (= E176), G207 (= G206), G211 (= G210), F225 (= F224), G227 (= G226), G228 (= G227), S231 (≠ T230), H331 (≠ Q329), F387 (= F382)
8vj3A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (fad bound)
40% identity, 97% coverage: 1:472/488 of query aligns to 2:477/488 of 8vj3A
8uzoA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (adp bound)
40% identity, 97% coverage: 1:472/488 of query aligns to 2:477/488 of 8uzoA
Query Sequence
>GFF2074 FitnessBrowser__Phaeo:GFF2074
MQQFQQYIGGVFSDGSARFESRDPASGEVWAMMPEARASDVEAAVAAARAAFHAPDWAGM
TATGRGKLLYRLADLIAENAETLAQLETRDTGKIIRETSAQIAYVADYYRYYAGLADKIE
GAHLPIDKPDMEVWLRREPLGVVAAVVPWNSQLFLAAVKIGPALAAGCTVVLKASEEAPA
PLLEFARIFDQAGFPRGVLNVITGFGADCGAVLTAHPGIDHIAFTGGPDTARHVVRNSAE
NLASTSLELGGKSPFIVFEDVDIDSAVNAQVSAIFAATGQSCVAGSRLIISNQIKAQFLH
RLKEKAENIRIGAPELPETEVGPLCTDAQMRRAVELVAASLAAGARIVTGGQPLEGEGNF
FPPTILDCSEAPEAPCLREEFFGPVLSVCGFDTEAEALALANDTAHGLASGVFTRDLTRA
HRMIRGIRAGIVWVNTYRAVSPIAPFGGQGLSGHGREGGLQAALDYTRVKTVWLRTSDDP
IPDPFVMR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory