Comparing GFF2084 FitnessBrowser__WCS417:GFF2084 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
40% identity, 93% coverage: 9:281/295 of query aligns to 2:259/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
40% identity, 93% coverage: 9:281/295 of query aligns to 2:259/261 of 3klcA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
40% identity, 93% coverage: 9:281/295 of query aligns to 3:260/262 of Q9UYV8
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
38% identity, 93% coverage: 9:281/295 of query aligns to 10:267/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
38% identity, 93% coverage: 9:281/295 of query aligns to 4:261/263 of 7ovgA
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
30% identity, 89% coverage: 22:285/295 of query aligns to 20:292/301 of 5h8iC
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
30% identity, 89% coverage: 22:285/295 of query aligns to 16:288/297 of 5h8jB
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
31% identity, 93% coverage: 9:281/295 of query aligns to 5:269/276 of Q9NQR4
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
29% identity, 89% coverage: 22:285/295 of query aligns to 17:289/298 of 5h8lB
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
31% identity, 86% coverage: 10:262/295 of query aligns to 7:281/304 of Q44185
8hpcC Crystal structure of c171a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-hydroxyphenylglycine
31% identity, 86% coverage: 10:262/295 of query aligns to 6:280/303 of 8hpcC
1uf8A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-phenylalanine
31% identity, 86% coverage: 10:262/295 of query aligns to 6:280/303 of 1uf8A
1uf7A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-valine
31% identity, 86% coverage: 10:262/295 of query aligns to 6:280/303 of 1uf7A
1uf5A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-methionine
31% identity, 86% coverage: 10:262/295 of query aligns to 6:280/303 of 1uf5A
P46011 Bifunctional nitrilase/nitrile hydratase NIT4; Cyanoalanine nitrilase; Nitrilase 4; EC 3.5.5.1; EC 3.5.5.4; EC 4.2.1.65 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 59% coverage: 3:176/295 of query aligns to 31:219/355 of P46011
Q9RQ17 Aliphatic amidase; Acylamide amidohydrolase; Wide spectrum amidase; EC 3.5.1.4 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
29% identity, 75% coverage: 42:261/295 of query aligns to 51:264/348 of Q9RQ17
Sites not aligning to the query:
4gylA The e142l mutant of the amidase from geobacillus pallidus showing the result of michael addition of acrylamide at the active site cysteine (see paper)
30% identity, 75% coverage: 42:261/295 of query aligns to 51:264/340 of 4gylA
5khaA Structure of glutamine-dependent NAD+ synthetase from acinetobacter baumannii in complex with adenosine diphosphate (adp)
26% identity, 84% coverage: 9:256/295 of query aligns to 4:241/526 of 5khaA
Sites not aligning to the query:
O25067 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
28% identity, 78% coverage: 42:272/295 of query aligns to 51:275/339 of O25067
Q9UBR1 Beta-ureidopropionase; BUP-1; Beta-alanine synthase; N-carbamoyl-beta-alanine amidohydrolase; EC 3.5.1.6 from Homo sapiens (Human) (see 4 papers)
29% identity, 66% coverage: 26:220/295 of query aligns to 94:292/384 of Q9UBR1
Sites not aligning to the query:
>GFF2084 FitnessBrowser__WCS417:GFF2084
MSEPASPARVAVIQLDPQVGMNNRSSNLHQSLALATEAANGGANLIVLPELTNCGYFFSS
RQDAFDHAELIPGGESVRAWIDFACKHQVYLVTGLCEIDGMQLFNTAVLLGPDGFIGKYR
KAHLWNLEKLWFTPGDTGFPVFETPIGRIGLLICWDIWFPEVPRILSQQGADIICSLNNW
VWTPPPLFDEAGKCMASYLTMTAAHVNNVFIAAASRIGEEREARYLGCSLIAGTNGWPIG
AVASANRQEILFADVDITSARSAPIWNSLNDLQRDRRIDLYDQMLGYSRHPALPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory